SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021349 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021349
Domain Number 1 Region: 274-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-18
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021349   Gene: ENSMODG00000017110   Transcript: ENSMODT00000021723
Sequence length 395
Comment pep:known chromosome:BROADO5:1:34795431:34800864:1 gene:ENSMODG00000017110 transcript:ENSMODT00000021723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGVPPGAPSSSWTAWGLRPSHSPSSRSLAGRALSDNIYPVEDLAAAAAATSVSIFPNA
DLGGPFDQMNGVTGDGMINIDMTGEKRPLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQY
PGASCYPEGIINIVSAGILQGVSAPASTTASSSGSSASPNPLAGGPLGVCTMSQTQPDLD
HLYSPPPPPPYSGCGGDLYQDPSAFLPSATTSGASSALAYPPPPSYPSPKPATDPGLFPM
IPDYPGFFPPQCQRDLHGPGGPDRKPFSCPLDSLRLTRHIRIHTGHKPFQCRICMRNFSR
SDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSGAPPPSSGGSSAS
CPGVTPSGGALCGGGGGGSLPGGPLASCTSRTRTP
Download sequence
Identical sequences F6UK91
ENSMODP00000021349 ENSMODP00000021349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]