SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021357 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021357
Domain Number 1 Region: 978-1228
Classification Level Classification E-value
Superfamily SET domain 1.06e-83
Family Histone lysine methyltransferases 0.0000333
Further Details:      
 
Domain Number 2 Region: 711-952
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.65e-71
Family Ankyrin repeat 0.000065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021357   Gene: ENSMODG00000017113   Transcript: ENSMODT00000021731
Sequence length 1268
Comment pep:known_by_projection chromosome:BROADO5:1:471276086:471439388:1 gene:ENSMODG00000017113 transcript:ENSMODT00000021731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADESSTEKQGGEPQMAADGETNGSCERNEANSHPNPAKHTQDNTKASPQEPAKLRIAE
NGISERDSDFGKQNHVKASDFTQTSLTGSNGYILTKPTLPEQPIRTTSTLASSLPGHAAK
TLPGGPSKGRTLSSFPHAQAAMPTKLGEGSKDLDHKKPTTTNPDVKVHRARKTMPKSIPS
LHAASKDPREVRDSRDHKESKEESNKNVTEFGKQQLLPPLSSLHQSLPQNQCYMTTTKSQ
TACLPFVLAAAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSIAHSTVGTKSEKDVG
DSSLHVNGESLEIDSEEDDSDDLEEDEDHGSEQASAFPVDDNRISNEGISEIDRAQKMED
GESEEEQESGESGEEEEDGDESDLSSESSIKKKLLKRKGKIDSPWIKPTRKRRRRNKKKQ
SSVLGTETYKSSLGSTGQAGQENSMDYMEVSLDSLDLRVKGILSSQSEGEFLSNGPEAVE
IDGLQEVPLCSCRMETPKSREITTLANNQCMATESIDNELGRCTNNVVKYELMRPSNNVQ
LLVLCEDHRGKMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASFVNNTSYCPHC
GEETSKAKEVTIAKADTTSTVSLTYVQEKPVTVEGRADTTTGSSGTHLSEEEKPESSTPQ
VPESGFELSGSSVFVKPTTGLSQGPVKETLESALIALDSEKPKKLRFHPKQLYFSARQGE
LQKVLLMLVDGIDPNFKMEHQNKRTPLHAAAESGHVDICHMLIQAGANIDTCSEDQRTPL
MEASENNHLDAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYDVVQYLLSNGQMDVNCQD
DGGWTPMIWATEYKHIDLVKLLLAKGSDINIRDNEENICLHWAAFSGCVEIAEILLAAKC
DLHAVNIHGDSPLHIAARENRYDCVVLFLSRGSDVTLKNKEGETPIQCSSLNSQVWGALQ
MNKTLQESSNEKPAQIERTMSRDIARGYERIPIPCVNAVDNEPCPSNYKYVSQNCVTSPM
NIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACS
CWRNCRNRVVQNGLRARLQLYRTQNMGWGVRSMQDIPLGTFVCEYVGELISDSEADVREE
DSYLFDLDNKDGEVYCIDARFYGNISRFINHLCEPNLIPVRVFMSHQDLRFPRIAFFSTR
QIEAGEELGFDYGDRFWDIKGKFFSCQCGSPKCKHSSAALAQRQASSSQDTQENGLPDTS
SAAAADPF
Download sequence
Identical sequences F6UJH7
ENSMODP00000021357 ENSMODP00000021357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]