SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021371 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021371
Domain Number 1 Region: 8-137
Classification Level Classification E-value
Superfamily POZ domain 1.2e-23
Family BTB/POZ domain 0.0017
Further Details:      
 
Domain Number 2 Region: 348-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.58e-19
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 3 Region: 384-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000196
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021371   Gene: ENSMODG00000017127   Transcript: ENSMODT00000021746
Sequence length 527
Comment pep:known_by_projection chromosome:BROADO5:2:189625358:189629094:1 gene:ENSMODG00000017127 transcript:ENSMODT00000021746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGQLCDLTIRTQGLEYRTHRAVLAACSHYFK
KLFTEGGGGTGAGGGAAASPGAGVCELDFVGLELGALLEFAYTATLTTSSANMPAVLQAA
RLLEIPCVIAACVEILQGSGLEAPGPDEDDCERARQYLEAFATVGSRVPNGDDSPLQAPL
PPPPPPTRPVPRRSRKPRKAFLQTKRPQTNHLVSDVAAMHPPSFTYPDEEEAASAIGVGD
GYSPPGGARSPPEGHLGYEGYEGEEEEEDLVYPPAYGLPQSGAPPLSPEELGSDEDAIDP
DLMAYLSSLNHEALTPGMDGQDKLVRKRRSQMPQECPVCHKIIHGAGKLPRHMRTHTGEK
PFACEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYDLKNHMHLHTGDRPFEC
HLCHKAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPQAPTPAGPGLDLSNGHLD
DFRLSLARFWEQPVRAGPPPPPLGPPEEEEEEGAPTTPQAEGAMESS
Download sequence
Identical sequences F6U3E7
ENSMODP00000021371 13616.ENSMODP00000021371 ENSMODP00000021371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]