SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021535 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000021535
Domain Number - Region: 351-356
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0139
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021535   Gene: ENSMODG00000017255   Transcript: ENSMODT00000021911
Sequence length 653
Comment pep:known_by_projection chromosome:BROADO5:2:421890124:422051783:1 gene:ENSMODG00000017255 transcript:ENSMODT00000021911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTNELKEMQMEAQEKMERVETLTSSVDGLDKASIANSDGPTTGSQTPPFKRKGKLSSIG
KIFKPWKWRKKKTSDKFRETSAVLERKISTRQSREELIRRGVLKELPDQDGDVTVNFENS
NGHMISIGEEATQEENIVKSEEGNGSLSEKATSVEEKAEDKKENPENHSETPAHPVPAPP
KPKPKPKPKKPAAPPKGAAALQASHKGDEAPPNKKTTKAPGKQPPIPPPKPTSRGVNREV
ASSSHLKKTAVSKSSSSPSTSTTSSRSKASKEPTSSKTAAAGTSRGKKKAGKQSTPRPPS
EKAVSATSNLKGEPLETRVENLKSDPSLPTSEEQNTDIQNKSVVPPPPVAPPPPPPAPPL
PLENQSINVSDIPAVTISDGASLSVSALDSSHPKTEEVTDRTTLSSDTSLGVNRENTKCL
TTKEELIKDAPRLMIPVLMGESSESLSSTEIEVRRENQANDSDSDGPILYTDDDDDDDDE
DDSSESALASKIRRRDTLAIKLGNRPSKKELEDKNILQRTSEEERQEIRQQIGTKLVRRL
SQRPTSEELEQRNILKQKNEEEEQEAKMELKRRLSRKLSLRPTVAELQARRILRFNEYVE
VTDSPDYDRRADKPWARLTPADKAAIRKELNEFKSTEMEVHEESRQFTRFHRP
Download sequence
Identical sequences F6TK17
ENSMODP00000039721 ENSMODP00000021535 XP_007484718.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]