SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021631 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021631
Domain Number 1 Region: 1792-1840
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000229
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 217-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000028
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 674-702
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000285
Family C2HC finger 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021631   Gene: ENSMODG00000017330   Transcript: ENSMODT00000022008
Sequence length 2471
Comment pep:known_by_projection chromosome:BROADO5:4:427739926:427831720:-1 gene:ENSMODG00000017330 transcript:ENSMODT00000022008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPEQSVKSAQTSEGSPRKRLPKGEAIQVSGPSTAPAPAPSLAPASAPSLAPALAPAPAP
APFQGSSTSSSATPLHELLSQPQHFTGPPLVLREGTQEKTGHQKPPKRSTIEGPPHIPQL
PQHPLSPAFMSPGKPEHLLEGPTWQLVEPIRPGPSGSFVSPGLHSQSQLLPAHPTIIPPE
ELQSIPKVYIPRASHISMKQAEEPPKKEKKPQKPGKYICQYCSRPCAKPSVLQKHIRSHT
GERPYPCIPCGFSFKTKSNLYKHRKSHAHRIKAGLASGIGAEMYPPGLEMERIGGEEFEE
PTEGESTDSEEETGASSSHPGDLSPRQKHTLLASSLYGAGSHGPGHDRCSSSHSGASQSL
EESPQFAEPLSSSEHSMSHKAEDTHTIKQKLALRLSERKKVMDEQAFLSPGSKGSTESGY
FSRSESAEQQISPPNTNAKSYAEIIFGKCGRIGQRTAMLTAAGNQPLLPLSAEDKPSLGP
ISVPRTQVIEHITKLITINEAVVDTSEIDSVKPRRSSLSRRSSIESPKAGIFRDPFQLDP
SKSLLSHSEKGKPEQSLLSLQQLPPSSTEPAPLLRSHSMPSATCTISSPHTFRGSYSFDD
HISESDTLSRSQVFTSHPRTLKRQPAFELPLGGEYSSEDIGLGPKDTASKPAEEKEVKES
ELTKKSRKGSKAKGITFECNICGARYKKRDNYEAHKKYYCSELQLAKPASTGTHPSSEAE
KNQGEPEPWSQMMHYKLGTGLELTPLRKRRKEKSLGDDEDTPSFESTKGHSSVGPGSQFT
NPAPSEASLNLPQEPIKPPAEPAPSVPPLEGTMAFHSRTPKPAASSESGKERRKISTEIS
VIQHTSSFEKPDPPEQLSHQEGEDKALSQFPSQPAVTPHGRYPHSLQPRLVRQPNIQVPE
ILVTEEPDRPDTEPEPPPKEPEKTEEFQWPQRSQTLAQLPAEKLPPKKKRLRLAEMAQSS
GESSFESVSLTRSPSLESSVSHASSHSASFEREDHGKTEAPGPSSETHSKSFGSHMLTVP
SYPHHSREMRRSASEQSPNIPHPSQISETRSKSFDYGSLSLAPPPTPGIPTSSAPPERRK
CFLVRQASLSRHPEHELPETEEPIPSSSKSCPKSLLHQPSSSSISSASTTSSASSTSSSS
SHGGYLSGKSQQKDSPQLVPSPPYTEALQVFHPPIPQLSLHEKPYLPPPVSLFSFQHFLQ
QPGQSSELFSTPAMPEIFSAPYSMPPLPHSLFQTPPIPLQQAVLHPGQLHMPHQLIPHPT
DLPFRQHPSFLPMPYPSSSSLSSGFFLPLQSQFALHLPGETGTHLPPVKSSLSPLTGPSG
LSPSTEYGTDVRLHPATRAASPPVSTAVPQLAIPSCPDPAVSLVVPVRIQTHMPSYGSVM
YTTLSQILVTQSQCSPSSLGLPKFDDYQAKGPLVCGVEAPGVGLELAQISEEQRRGFPTP
YLRVPLAERKGSSLSSEGILGLEGSPSTAGGSKRVLSPAGSLELTTETQQQKRVKEEEGS
KADEKLELLRPAGTILAGAEGGKRQERAQFGGPSHGRGEEETLPSSSLTQPHPKDSPPSQ
YSGLPHSGAPGLEASKQLPGKPSRRQSPLQAVKKEDSKDLPDHPPKTPPTSSSTSPRTAK
SREGTDAKKVLQFPSLHTTTNVSWCYLNYIKPNPVQQADRRSSVYAGWCISLYNPNLPGV
STKAALSLLRSKQKISKEIYTMAMAPHPETGRLVPSSSRKPRMTEAHLPSMVSSEGRKDL
ARPEKEEDKRGKPEEEAPASKRGEPGRIKIFEGGYKSNEEYVYVRGRGRGKYVCEECGIR
CRKPSMLKKHIRTHTDVRPYVCKHCHFAFKTKGNLTKHMKSKAHSKKCQEMGLLVELETE
EGASDDPFQDSEGREGSEAVEEHQFSDLEESDEDEDNEDDEEEEEEEESQDEPTLKPSEG
PLSAGHSKVSSPPAQDRSPRATPSLPQDVTSCDQPTASLRLEARWPADWSDATTCQSHLC
LHQPVLMSQEPLAPTEQELGPNQQAGILAMGPLLSSQATSPRRPWSPGKEPCSSRPMVPR
KHSLTKNESPPQRFAPTGDLLSFQCGSPGRGISPSPWMVSPLRCMSPSIHLSPRRELSPR
AYLPPEGRVSPERNLSPSQEMIPIRHSSPKKMSPGLSESPPRYPLPGKDDLAFISGTTAD
EQTLGSIPVAQRGLFSQKPLPHKLLGKNVETSESKTKLEPRSPACSPGPAHPFPFRPFSS
LHEFHGHPPGRTGENLFSHLPLHSQRLARTPCPMIPIGGIQMVQARPSSHPTLMPGAGGP
WSSCFFGGGSDLTDSRQAQERSREGPPETSSASVSPVAKVSKFTLSSELESSSYSLERMR
TSEGQGVPRWERPRPGGASSETKAPALTDSPGSEPAPRPSPGRPGQAKRPSPCTDSETPR
TFPSAFPSQTLDRSSSTGCLMEPARCPGPRRRNLSGELRPSAGPRRRLGSPPLESEGPGP
TPGRPEDGGGS
Download sequence
Identical sequences F6WVU0
ENSMODP00000021631 XP_007492984.1.35504 XP_016278025.1.35504 XP_016278026.1.35504 XP_016278027.1.35504 ENSMODP00000021631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]