SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021662 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021662
Domain Number 1 Region: 113-143,254-407,473-599
Classification Level Classification E-value
Superfamily Pseudouridine synthase 7.48e-93
Family tRNA pseudouridine synthase TruD 0.0011
Further Details:      
 
Domain Number 2 Region: 698-856,1151-1319
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-77
Family Protein kinases, catalytic subunit 0.000000209
Further Details:      
 
Domain Number 3 Region: 656-666
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021662   Gene: ENSMODG00000017361   Transcript: ENSMODT00000022040
Sequence length 1320
Comment pep:known_by_projection chromosome:BROADO5:8:156434150:156822701:-1 gene:ENSMODG00000017361 transcript:ENSMODT00000022040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METVEVTGVSMKRSLSTDENDDLTQADEAKRRKVSECNLAKDQETLDNDCALSNEIVTRQ
SETPTAGEGRNNVEVQIEEEEEEEDGFLEEEEEEEDGEVESFADMMKHGLSEVDVGITKF
VSSHQGFSGILKERYSDFVVHEIGKDGRISHLDNLSVPVDDEDPSEDVFTVLTEEDKQRL
EELQLFKNKETSVTIEVVEDTKEKRTIIHQAVKSLFPGLETKTEDREGKKYIVAYHAAGK
KALAKVRTATDPRKHSWPRSRGSYCHFVLYKENKDTMDAINVLSKFLRVKPNIFSYMGTK
DKRAITVQEIAVLKITAQRLAHLNKCLMNFKLGNFSYQKNPLKLGELQGNHFTVVLRNIT
GTDHQVQQAMNSLKEIGFINYYGMQRFGTTAVPTYQVGRAILQNCWDEVVDLILKPRPGA
EKGYLVKCREEWAKTKDPDAALKKLPVKRCVEGQLLRGLSKYGLKNIVSAFGIIPRNNRL
MYIHSYQSYVWNNMVSKRIEEYGLKPVQGDLVLKGATATHIEEADVNSYSIHDVVMPLPG
FDVIYPKHKISEAYKEMLTADCLNIDNMRHKIRDYSLSGAYRKIIIRPQNVSWEVVSYDD
PRIPLFNTDLDNLEGKPPPVFATEIKQKIELLMSVNSEKSSSSERPEPQQKAPSVPPPPP
PPPPPPLPEPAPPEPEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWG
HFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLID
DFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPIHCVKSIIRQVLQGLDYLHSKCKI
IHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKK
KLKKKQKRQAELLEKRLQEIEELEREAERKKVEENITSAIPTNDQEDEYHPEVKLKTAGL
EEAADEEPANDEGEPEDQEEKEDTEKENTEKDDDDVEQELANTDPTWIESPKTNGHIENG
PFLLEQQIEDEEDEEEECPNPEEYNLDEHEPNTESDYTYGSSYEQFNGDLPNGQHKIPES
QFSEFTASMFSGALESVACGSAVSEGSVLTEQEENSPTHDRSRTVSASSTGDLPKTKTRA
ADLLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIW
STACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRG
ELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS
Download sequence
Identical sequences F6VZX3
ENSMODP00000021662 ENSMODP00000021666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]