SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021684 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021684
Domain Number 1 Region: 114-195
Classification Level Classification E-value
Superfamily RING/U-box 1.02e-16
Family RING finger domain, C3HC4 0.0064
Further Details:      
 
Domain Number 2 Region: 282-336
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000707
Family RING finger domain, C3HC4 0.0063
Further Details:      
 
Domain Number 3 Region: 187-255
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000406
Family IBR domain 0.069
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021684
Domain Number - Region: 71-78
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000225
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021684   Gene: ENSMODG00000017373   Transcript: ENSMODT00000022062
Sequence length 730
Comment pep:known_by_projection chromosome:BROADO5:4:426385016:426408642:-1 gene:ENSMODG00000017373 transcript:ENSMODT00000022062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEKDSESPRSTSLPAATPDPKCRGGGGRRHRFLSSLVLLPAGRSRRARAKPPPPALAP
APAPAEPPAPPPPPPPPPAPPEAPPAEPAPEAEVAVAAAATVAAAGEEGPGPGGDEVECP
LCLVRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRVPVSCPECSERLNPHDIRLLLA
DPPLMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASCPKLTCEREGCQTEFCYH
CKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPADDIKPCPRCSAYIIKMNDG
SCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVG
ISLIAGIAIPAMVIGIPVYVGRKIHSRYEGKKTSKHKRNLAITGGVTLSVIASPVIAAVS
VGIGVPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWRALKNPS
IGESSIEGLTSVLSTSGSPTDGLSVMQGNYSETASFAALSGGTLSGGVLSSGKGKYSRLE
VQADIQKEIFPKDTASLGAISDNASTRAMAGSIISSYNPQDRECNNMEIQVDIEAKPSHY
QLVSGSSTEDSLHVHAQMAENEEGSEEEPPCKHQSCDHKDCIASKTWDITLAQPESIRSD
LESSDTQSDDVPDITSDECGSPRSQTAAHPHTPRARGAQSPSAHMNHCAQGEGHKSEEMV
LKLEDIEIRV
Download sequence
Identical sequences F6VID8
ENSMODP00000021684 ENSMODP00000021684 XP_001381433.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]