SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021728 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021728
Domain Number 1 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 68-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 328-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 112-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.46e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 30-82
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-18
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 168-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.32e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 370-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000013
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 8 Region: 232-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000767
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021728
Domain Number - Region: 403-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000613
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021728   Gene: ENSMODG00000017407   Transcript: ENSMODT00000022106
Sequence length 434
Comment pep:novel chromosome:BROADO5:Un:92515371:92516828:1 gene:ENSMODG00000017407 transcript:ENSMODT00000022106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDRRKKCNELTKWRKTGRAEHYCHHQSRERRYNCSECGKAFQEKGHLKRHYRIHTGEKPF
KCSECGKAFQEKEHLKRHNRIHTGEKPFKCSECGKAFQQKGHLKIHYSIHTGEKPFKCSE
CGKAFQHKGLLKYITHTGEEPFKCSECGKPFQQKGDLKIHYRIHTGEKAFKCSECGKAFS
RAGTLKGHQSTHTGEKPFECNECRKTFRRNFELTIHSSIHTERNPLNAVNVGRHFARNSH
LLSHQRRIHEGFKLHECNVCGKAFSRKYDLTTHTRIHTGEKPYECRECGKAFYSKSDLAK
HSRIHTGEKPFECSECGKAFARNSHLLTFYGKYDLTTHSSIHAGEKPYECSECGKAFSSK
SYFTHHSRIHAGEKPFQCDICGKVLLSKFNLNRHQKTHIEEKPFLCSVCGKFHGKKTLTA
HQRTHAGKRTSECS
Download sequence
Identical sequences H9H729
ENSMODP00000021728 ENSMODP00000021728 13616.ENSMODP00000021728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]