SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021747 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021747
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily POZ domain 3.31e-34
Family BTB/POZ domain 0.00059
Further Details:      
 
Domain Number 2 Region: 318-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000289
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021747   Gene: ENSMODG00000017424   Transcript: ENSMODT00000022126
Sequence length 481
Comment pep:known_by_projection chromosome:BROADO5:4:425878064:425939098:1 gene:ENSMODG00000017424 transcript:ENSMODT00000022126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISSHQSHLLQQLNEQRRQDVFCDCSILVEGKVFKAHRNVLFASSGYFKMLLSQSSKET
NQPTTATFQAFSPDTFTVILDFVYSGRLSLTGQNVIEVMSAASFLQMTDVISVCKTFIKS
SLDISEKEKDRYFSLSDKDANSNGVAERSYSAGWHGESSPPQSHLSPDQGTCAMSGKSWS
NYNYYPTSQWNTQQPPTKHEQRQDLVKKSRPLELPQSTDVPHYKLSKLEDRTSEAPNHTP
PSEEKVQNDAGIDCSHVGLTYGKESDVTPRSLPDAHQEQESSRSTCKSPKTDKPCSKMPL
ILGVMGSWNEDELPKMRFKCPFCTHVVKRKADLKRHLRCHTGERPYPCEACGKRFSRLDH
LSSHFRTIHQACKLICRKCKRHVTDLTGQVVQEGTRRYRLCNECLAEAGLDSIPINLEAE
QPLVSPSDGEKKSKWQLSEGKKKSYVEIVEDGSADLIIQQVDDSEDEKEEKEIKPNIRKL
I
Download sequence
Identical sequences F7AIS9
XP_007492952.1.35504 XP_007492953.1.35504 ENSMODP00000021747 ENSMODP00000021747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]