SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021751 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021751
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily POZ domain 1.37e-30
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 347-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000313
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021751   Gene: ENSMODG00000017428   Transcript: ENSMODT00000022130
Sequence length 487
Comment pep:novel chromosome:BROADO5:4:425804702:425831689:1 gene:ENSMODG00000017428 transcript:ENSMODT00000022130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMQSYYTKLLGELNEQRKRDFFCDCSIIVEGRIFKAHRNILFANSGYFRALLIHYIQDS
GRHSTASLDIVTSEAFSTILDFLYSGKLDLCGENVIEVMSAASYLQMTDVVNFCKTYIRS
SLDICRKMEKEAAAAVAAAAAAVAAHQVDSGSSVSGREVTSCGPKNQCPILMPLPEEREQ
VGNCHQDTSCEGCTSCHPLELVVKGPPGSDSVDDLPSLPKGTEPKVEFDSDEVEVEVEVG
DRLQQYSAPLALEPMEGVLPGSQALDLACNNYHMKQFLEALLRNSTTQSKEDAAHFSRGF
ESRPEEGVAVSSMMDIPSDWYGEDTGDVLVVPIKLHKCPFCPYTAKQKGILKRHIRSHTG
ERPYPCDTCGKRFTRQEHLRSHSLSVHRSNRPIICKGCRRTFTSSLSQGLRRFGLCDSCT
CITNPQDESVPINLSQMEASSEGPEKGEPDSDWPIYVESGEENDPTGDDSDDKQQLHRSL
LDREALM
Download sequence
Identical sequences F6ZVE4
13616.ENSMODP00000021751 XP_001381364.1.35504 ENSMODP00000021751 ENSMODP00000021751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]