SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021780 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021780
Domain Number 1 Region: 354-373
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000016
Family Formin homology 2 domain (FH2 domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021780   Gene: ENSMODG00000017453   Transcript: ENSMODT00000022159
Sequence length 441
Comment pep:known_by_projection chromosome:BROADO5:2:411695240:411757509:-1 gene:ENSMODG00000017453 transcript:ENSMODT00000022159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLMLNLFRQLLEYFGFPLEQFTPIWEAHANGRSIVRVIVTSLPSNLFSRTDLYQICSTI
LPSWENKEYGSTRSIVRSIGKILPLEPCPRPNFELFQYMKSLDCDQHGSALNPIVPSFAD
ILCVANDEARQDRFRNCIWEKYEDKTQFFNPMPPPLIPLSPVSSQRMQIINGLPVTKAAI
KKIAALQDELTILRSQIAAIVALQEAENKFTLESLKSYDIPGNLGPLPSVTSSPSPVPDC
SSNSVVHPLPPPPPPPPPPLPPLPPPPPSSPGSNICDSDSSTDRLIKEVHIANKNNTEKY
AENQRTKVVPSMMDVLKDMDKVKLRAIERSPGGRPIHKTRREISDWDPVSIISHALKKKF
AFQEEDSFEKEDTSWDSSFFSPETPKFEHRILQPNGQCMEEEIDKVSQRKEDERKEEGKE
KDEKKGAKQRPELMRKKCGGK
Download sequence
Identical sequences F6Z5S7
ENSMODP00000021780 XP_007484662.1.35504 XP_007484663.1.35504 XP_007484664.1.35504 ENSMODP00000021780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]