SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021826 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021826
Domain Number 1 Region: 188-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 576-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.9e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 230-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.85e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-19
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 5 Region: 482-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 132-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.96e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 618-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 96-146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-17
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 9 Region: 397-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000489
Family Classic zinc finger, C2H2 0.061
Further Details:      
 
Domain Number 10 Region: 298-320,357-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000193
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021826   Gene: ENSMODG00000017494   Transcript: ENSMODT00000022206
Sequence length 1125
Comment pep:known_by_projection chromosome:BROADO5:Un:55164785:55169111:1 gene:ENSMODG00000017494 transcript:ENSMODT00000022206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSDARGRQFVCAAAAAQAWLPRAGASGRRPSLSGLPGTPTFQASLASGPPASYPSGAVG
AMVGSPLDMAPAPTTEGPREPPAPPAAAPPAAAAQYECGECGKSFKWSSRLLHHQRTHTG
ERPYKCPDCPKAFKGSSALLYHQRGHTGERPYPCPDCGKAFKRSSLLQIHRSVHTGLRAF
TCAQCGLAFKWSSHYQYHLRQHTGERPYPCPDCPKAFKNSSSLRRHRHVHTGERPYPCGV
CGKSFTQSTNLRQHQRVHTGERPFRCPACPKTFTHSSNLLLHQRTHGAAAAPGAGSSHRC
EPCGKVFASDAYLQRHLQTHAPAAPAPAPAAPPEDPPPPPPPPPVVPELFLAAAETTVEL
VYRCGGCELAFASESLLLEHQPCPGPGLEAAAQPAAFTCSPCGKAFKTAAGLTRHQQSHG
PAGAPAYRCGGCDRAFPQLASLLAHQWAHTEEALPQAEAAEVTCPQEAPAPGPAAPAPPG
DRPYKCAECGKAFKGSSGLRYHMRDHTGERPYPCGECGKAFKRSSLLAIHQRVHTGLRAF
RCAQCGLTFKWSSHYQYHLRLHSGERPYPCAECGKAFRNTSCLRRHRHVHTGERPHACGV
CGKSFAQTSNLRQHQRVHTGERPFRCPACPKTFTHSSNLLLHQRTHSAERPFACTVCGRG
FVMAAYLQRHLRTHAPAAPAPTPAPAAATTQDVHVVPHLQATLSLEAGPSPANSQTFLLV
QTAQGLQLIPSSVQPPAPTPPPSTPPAPPKLILLPASGARKSPKDGGRAGQGPGMVWLPA
PGAVSGQGGGPGLAGGGGQSLIVLQSVGGGEVGPQETRGVRLQSLQPAQEVTTVQLQPLQ
PAQEVTTVQLQPLQPAQEVTTVQLQPLQPAQEVTTVQLQPLQSAQEVTTVQLRPAQEVTT
VQLQPLQPSQEVTTVQLQPLPPTPDVSLQLQPVSSPLASPGGSGGPAEAQNLLVVQGGAG
EELLATPGPSGDVGSGEGDGGGGGAVVQDVHFETLQTAEGLQSVLVLSGADGEQTRLCVQ
GVETLPPGLAESPAPGTQAQKLLIIRSAPAAPADLVENVPAAPLQLLAPPSPAPVPAGAP
PGPSPQVVQVVPGAAAGPAGGAGQPALPSIHIVQALPAVQLVHTF
Download sequence
Identical sequences H9H733
XP_007506749.2.35504 XP_016282897.1.35504 XP_016282898.1.35504 ENSMODP00000021826 ENSMODP00000021826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]