SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021887 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021887
Domain Number 1 Region: 194-288
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.45e-40
Family Forkhead DNA-binding domain 0.0000285
Further Details:      
 
Domain Number 2 Region: 44-98
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000000141
Family beta-sandwich domain of Sec23/24 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021887   Gene: ENSMODG00000017542   Transcript: ENSMODT00000022268
Sequence length 503
Comment pep:known_by_projection chromosome:BROADO5:1:211551833:211553341:-1 gene:ENSMODG00000017542 transcript:ENSMODT00000022268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDMGDRKEVKMIPKSSFSINSLVPEAVQSDNHHAGHGHHNSHHPPPHHHHHHGHHHHHH
PPPPPPPQQQQPPQQQQQQQHPPPPQPPQAPQARSAPTDDDEDKGPQQLLLPPPPQGATS
AATASAALDGAKADGLGGKGEPGGGGGGGAGDLAPVGQEEKEKGSGGEEKKGAGEGGKDG
EGGKEGEKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQ
NSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAF
KRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLT
QNSLGNNHSFSTSNGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCS
VNLLAGQTSYFFPHVPHPSMTSQSSTSMTARAASSSTSPQAPSTLPCESLRPSLPSFTTG
LSGGLSDYFTHQNQGSSSNPLIH
Download sequence
Identical sequences F7E1E1
ENSMODP00000021887 ENSMODP00000021887 XP_001364896.1.35504 13616.ENSMODP00000021887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]