SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021988 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021988
Domain Number 1 Region: 643-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000341
Family Classic zinc finger, C2H2 0.056
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021988
Domain Number - Region: 1056-1084
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000206
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 1102-1126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000596
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number - Region: 1387-1412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00408
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 691-724
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0044
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 1250-1276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00493
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 876-904
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00763
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 1302-1330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.063
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 722-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0634
Family Plant C2H2 finger (QALGGH zinc finger) 0.074
Further Details:      
 
Domain Number - Region: 1349-1375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0696
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021988   Gene: ENSMODG00000017631   Transcript: ENSMODT00000022375
Sequence length 1861
Comment pep:known_by_projection chromosome:BROADO5:4:424213710:424325635:1 gene:ENSMODG00000017631 transcript:ENSMODT00000022375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLQYAGNRNTSEHLACLLEVYRLSIQSFANARPYLTTECEDVLLVLGRLVLSCFELLL
SVPETELPCEVWVPFNKSIQDSHDALLEFGNNNLQVLVDITKEGVWKNPILLKILSQQPV
EVEEANRFLAREGPSFLQMRIKHLLKSNCITQATSLSKLCAESKEISNVSSFRQAYITCL
CSMLPSEDAIKEIAKLDCKEVLDIICNLESEGQDHTAFILCTTYLTQQLQTASVCYSWEL
TLFWSKLQRRIDPSLEIFLERCRQFGVIAKTQQHLFCLIRVVQAEAEDAGVSVSILLCVR
ALQIQSNEDDEMKTSVCKTIGCLLPEDLEVRRACQLTEFLLDPNWTGFNMLEELYLQPDQ
KFDEENAPVPNSLRCELLLALKAHWPFDPEFWDWKTLKRHCHQLLGQEASDSDDDLSGYE
MSINETDVLESFLSDYEENKDDKHSKRRDSTDQQKEKRDKKPIGSSERYQRWLQYKFFCV
LCKRECIEARILHHSKMHMESGVYTCPVCIKKFKKKEFFVPHVMEHVKMPSSRTRRKLLM
KRDRSLKGNSSKRSPSATSHQDQLCNKQGDSHEYVTFSKLEDCHLQDRDLYPCPGTDCSR
VFKQFKYLSVHLKAEHQNNDENAKHYLDMKNRREKCSFCRRHFMTAFHLREHEQVHCGPQ
PYMCVSIDCYATFGSVNELLNHKQKHEDLRYKCELNGCNSVFSDLGQLYHHEAQHFRDAS
YTCSFLGCKKFYYSKTEFQDHLSMHHDISNGDVKSTVKFESAANEKNSCRDLPHLLDPTE
KSHLPEDLLFSVDSSSSQLAPDIEETGSDNLKDNSDSNSSDQLSHSSSASMNEELIDTLD
SPESMSDILIPSHDKVFVPSSLKEKCSNVAVCFDGKKFTCGFEDCGSTYKNARGMQKHLR
KVHPYHFKHKKTLGIKDKEIFKFLDGEHDQTNEKFNAEPKPGSDTNSDSPDEGLDHNIHT
KYKSDLQSCHHSPEATICASRVPCTEDAMLELLLRLKHLSLKNSITHTSFSGSLPVYPSN
GAKSLQSVSSSPISDLHFQNQEENLSSQYLAQLAAKPFFCELQGCKYEFVTREALLMHYV
KKHNYSRDKVLQLSMFKHRYSPFQCHICQRSFTRRTHLRIHYKNKHKISNEKVTHKLFDS
GKCDHVSPCTGDNAMGSCSASTFCSSTELGDDQTNNSEKQIRHPKKEECSSETDLESSCE
EIDSNVTGKSSSISSPIDSHREELEAREGRGSRRTVAKGNLCYILNKYHKPFHCIHKSCN
SSFTNLKGLIRHYRTVHQYNREQLCLEKDKARTKRELVKCKKIFACKYKECNKRFLCSKA
LAKHCSDSHNLDSVEDQKALSENDSAARFSCSQPQCPAVFYTLNKLKHHLMEQHGIEGEM
NSDFEIHCDLNGCDRIFTHQSNYSQHVYYRHKDYYDHLFGNPKVDNESLLKNEGEKAFGT
TRSHSETSQNNKKALNAKTKRCGGFVKDKKLFLKTKEEALNMCAEQSEHTQYPCMIQGCS
SVVKLESSILRHYKRTHQMSSAHLEQQMEILVLCVKYGTKIKEEPPSELEPSIKKEETRN
CDPGSTAHTQSVGENEASPQKGNSSPHPENKGNGSQEGCIESKSGFNTDTFLYRETSKYN
HNSETTNLEEGHVTEPSPCKNEKSAPKNPDGTESRPYLTNFQLPLPRKRVPEAGHQSSRL
ESNVVKTPIHTPKDTFRKHSQARSFDLKTYKPMGFESSFLKFIQESKEKEDDVDDWEPAD
HLTVNDPPQPSDDLAGNVTVDGLVNESSPKVDIPPPSSDSAIHDNLVAIQPIIEAESSAV
PSLENLRVILDKALTDCGELALKQLHYLRPVVVLERSKFSTSLLDLFPTKKTDELCVVGS
S
Download sequence
Identical sequences F6ZSB3
ENSMODP00000021988 ENSMODP00000021988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]