SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022018 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022018
Domain Number 1 Region: 15-135
Classification Level Classification E-value
Superfamily POZ domain 4.12e-28
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 502-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000145
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 432-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000527
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022018   Gene: ENSMODG00000017662   Transcript: ENSMODT00000022405
Sequence length 614
Comment pep:known_by_projection chromosome:BROADO5:3:510862213:510864054:-1 gene:ENSMODG00000017662 transcript:ENSMODT00000022405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLRLPQVVGWDSGPPAAMELPNYAKQLLVQLNQQRAKGFLCDVIIVVENALFRAHKNVLA
ASSVYFKSLVLHDNLIHLDTDMISPTAFRQVLDFMYTGRVLPAESPAEPNFHTLLNAANY
LQLPELAALCRRKLKRPGKSFGSGRAGLPGVGRPGRGQRLSTASVIQARYPASEGRKAAL
APKELPQSKGSDDELFLGGQENSHPLSRMGCKNGGGGDGASCGGSSGHSGGSEQELGLDL
SKKSPPLPPSAPGPLLGPDDLAQLSDSQHDSPAPASTNSASYPEPSGPLEDPMEVEGSGG
PEENHLGLLEGPGAPPRKSLRHLARKKEWSKAEAVACASFERKEAAGGKSCCPGDEDELD
DGLPNGILGSSAGPYGEPPYPCKEELENGKELSDDSGQSDGEGPGGPAGAGPGGAGANYV
YRQEGFEAVPYGDNLYVCIPCGKGFPSSEQLNAHVETHTEEELFIKEEGGYGAGPAPEDE
AEDLSAPSPAYASAAAAANEQRPFKCSGCDKSYKDPATLRQHEKTHWLTRPFPCSICGKM
FTQRGTMTRHMRSHLGLKPFACDECGMRFTRQYRLTEHMRVHSGEKPYECHLCGGKFTQQ
RNLISHLRMHTSPS
Download sequence
Identical sequences F6YJW0
ENSMODP00000022018 ENSMODP00000022018 13616.ENSMODP00000022018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]