SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022214 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022214
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 9.16e-39
Family SCAN domain 0.0000675
Further Details:      
 
Domain Number 2 Region: 800-856
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 743-800
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 841-893
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-18
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 5 Region: 695-744
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000777
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022214   Gene: ENSMODG00000017820   Transcript: ENSMODT00000022603
Sequence length 901
Comment pep:known_by_projection chromosome:BROADO5:1:201269715:201283703:-1 gene:ENSMODG00000017820 transcript:ENSMODT00000022603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSETFRQRFRKFHYQEVAGPREAFSQLWELCCRWLRPEVRTKEQILEILVLEQFLTVLPG
EIQTWVQDHCPESGEEAVTLAEELEKEPKRPECRVRREGGPEKMAPLRSPLELLSVRQEA
VESQPKVVAKKEGAGCPEPGPQEQLNLKEKLRLHQRTGKKYRYVIAFWPTHSTTQLKMNM
LLCTFCIEQGTMKYKGYKQLLALKDLMFCKNHLVLCLLLYEQDFLSPNLAWFLGQREENH
EVPDLGSKERELSRSSHTGDKRMHSDLLPSRRERKNWGDQEQWGFEDEKVAGVHWGYEET
RTLLAILSQTEFYEALRNCHRNSQVYGAVAERLREYGFLRTLEQCRTKFKGLQKSYRKVK
GGHPPETCPFFEEMEALMSAQVIALPSNGMEEEAAAHPGLVASDAETEDQEHGAWQQEEA
AEEATVEDSDGDETGAQESGSPSAPVLFRSPSGVHWGYEETKTYLAILSETQFYEALRNC
HRNSQLYGAVAERLWEYGFLRTPEQCRTKFKSLQTSYRKVKSGHAPETCPFFEEMDALVS
TRAAAPPSDGLEEEAGPHSGLVASDGETEEQDQEGWQQGEAAEEVMATAEDSEGEEVGAE
EAPRSSGSPGAPVLFQSPRGFEAGFENKQNTKRDISEEVELHRTLLARSERKIPHRFNQG
KDSDSDCKSGRQWAKSPVERRGKLTPPEKGLGKILSHQKPFLGDKPYKYLRYGKSFGPNS
HLLMHQIPHQIENPYKCGDCGKSFSRSARLIRHRRIHTGEKPYKCLDCGKSFRDSSNFIT
HRRIHTGEKPYQCGECGKRFNQSSSLIIHQRTHTGEKPYQCEECGKSFNNSSHFSAHRRI
HTGERPHVCPDCGKSFSKSSDLRAHHRTHTGEKPYGCHECGKCFSKSSALNKHREIHTRE
K
Download sequence
Identical sequences F6ZXN2
ENSMODP00000022214 13616.ENSMODP00000022214 ENSMODP00000022214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]