SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022274 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022274
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000474
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022274   Gene: ENSMODG00000025304   Transcript: ENSMODT00000022663
Sequence length 87
Comment pep:novel chromosome:BROADO5:7:55758771:55760308:1 gene:ENSMODG00000025304 transcript:ENSMODT00000022663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTHSGDKPFKCVVGGCNASFASQGGLAHHVPTHFSQQNSSKVASQPEAKEESPSKAGMN
KRKLKNKRRRSLPRSHDFFDAQTLDAI
Download sequence
Identical sequences F6YI81
ENSMODP00000022274 13616.ENSMODP00000022274 ENSMODP00000022274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]