SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022336 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022336
Domain Number 1 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 447-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.8e-23
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 5 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 6 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 7 Region: 492-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 171-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.13e-19
Family Classic zinc finger, C2H2 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022336   Gene: ENSMODG00000009927   Transcript: ENSMODT00000022726
Sequence length 550
Comment pep:novel chromosome:BROADO5:3:525942863:525948962:1 gene:ENSMODG00000009927 transcript:ENSMODT00000022726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTFKDVAVDFTQEEWCLLDHSQKELYLEVMLENVQNLLSVGLQVPRENFISSFHQGKAPW
LLEQKGPKSSFPETETNFEVKEMSTKLTLFVEGFGPERCLNDGPHVFILREIYDSNIKVN
KSPKSDCEFGDTAEKLSQYTILNQGMKLTSRNDCCQDSEYRRCFSEEVRFNSDLSAHHQI
QDGEKPFECKQCGKTFKQKGHLAKHQSIHSAEKPYECEQCGKTFKRRDHLVAHQRIHNGE
KPYECEQCGKAFSYRGSLAAHQRIHTGEKPYECEQCGNAFLHRGSLTAHQRIHTGEKPYE
CKQCGKIFKRREYLAAHQRIHTGEKPYECKQCGKTFKRKSHLAAHQSIHSVEKPYECKQC
GKAFTWKVSLAAHQSIHSGQKPYECKQCGKTFTWKVSLTAHHSIHSGQKPYECEQCGKTF
TQRSHLAAHQSIHSGEKPYECKQCGKTFKRRDVLVAHQKIHTGEKPYECEQCGEAFSHKG
SFAAHQRIHTGEKPYECKQCGKTFKRKDILVTHQKIHTGEKPYECKQCGEAFSHRGSLAA
HRRIHTGEKP
Download sequence
Identical sequences F7F2R1
ENSMODP00000022336 ENSMODP00000022336 13616.ENSMODP00000022336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]