SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022401 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022401
Domain Number 1 Region: 12-128
Classification Level Classification E-value
Superfamily POZ domain 2.47e-26
Family BTB/POZ domain 0.0014
Further Details:      
 
Domain Number 2 Region: 417-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 304-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 460-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-17
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 5 Region: 346-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022401   Gene: ENSMODG00000017966   Transcript: ENSMODT00000022791
Sequence length 653
Comment pep:known_by_projection chromosome:BROADO5:2:375010557:375028283:-1 gene:ENSMODG00000017966 transcript:ENSMODT00000022791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEETPVSSEKLVVYSEAHSDTILANFEEQRKRGFLCDITLIVENVHFRAHKALLAASSE
YFSMMFAEEGEIGQSIYMLEGMLADTFGILLEFIYTGYLHASEKSTEQILATAQFLKVYD
LVNAYTDYQSNHSSTNPTTLTTGGTPVVVISNKKNDDPPKRKRGRPRKVKNMQVTKPEIV
SLEDIQLRENNSVQNKQNSMAKTVEGSTSITNEQNQIREIEESERACGSSAVEMPAEEDE
NCDPKSQDVQGSQSRYSKRRIQRSVKLKDYKLVGDEDDQYSAKRISGRRKRSGSEARCKE
CGKVFKYNHFLAIHQRSHTGERPFKCSECGKGFAQKHSLQVHTRMHTGERPYTCTICSKA
LTTKHSLLEHMSLHTGQKSFTCDQCGKYFSQKRQLKSHYRVHTGHSLPECNHCHRKFMDV
SQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCGICGKSFSDSSAKR
RHCILHTGKKPFSCPECNLQFARLDNLKAHLKIHSKEKPFPEAPSAPSSSNPEEVRNILQ
LQQYQLSTSGEQEIQLLVTDSVHNINFMPSHSQGISIVTAEGTQSMAADQAADLTVLTQQ
PEHLQSLILSAQPDQTEHIQSLNMMDSQIETSPAEQVHIITLSKETLEHLHAH
Download sequence
Identical sequences F7BVH7
XP_001378966.4.35504 13616.ENSMODP00000022401 ENSMODP00000022401 ENSMODP00000022401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]