SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022422 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022422
Domain Number 1 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.17e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-26
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 655-712
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 711-768
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.45e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 600-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 767-824
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.03e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 10 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.77e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 11 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 12 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 13 Region: 809-861
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 14 Region: 126-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 15 Region: 450-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000011
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022422   Gene: ENSMODG00000022671   Transcript: ENSMODT00000022812
Sequence length 880
Comment pep:novel chromosome:BROADO5:Un:58328215:58346103:1 gene:ENSMODG00000022671 transcript:ENSMODT00000022812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALERDRRPAQEVVTFKDVAVDFTKEEWCLLTPPQKVLYKEVMLENARNLVSVGLAVSRG
DVISYFEQREAPWMLEQEDLGIGCPDSEIRPEIKVIPTEASLSVEEMGQQQFISGGPYTL
VYREFQNSSLIEHQRIHTEEKSTEHNQCGKTFNVSSRLAVHQRIHTWEKYYECKQCGKTF
SVRSRLAVHQRIHTGEKPYECKQCGKTFRESYSLAVHQRIHTGEKPYECKQCGKTFSQSS
HLVQHQRIHTGEKPYECKQCGKTFSVRSHLAGHQRVHTGEKPYECKQCGKTFSVSSSLAV
HQRIHTGEKPYECKQCGKTFSVSSSLTCHQRIHTEDKPYECSPCEQTFSVSSNLSKHQRI
HSGDKPYECKQCGKTFSVSSSLTKHLRIHTGEKPYECKQCGKTFSVSSNLAVHQRIHTGE
KPYECRLCGKTFSVSSSLSVHQRIHTGEKPYECKQCGKTFSVSSSLACHRRIHTGKKSYE
CKQCGKTFIDNSHLVYHQSIHTEDKPYECSQCEQTFRESSHLVHHQKIHTGEKPYECKQC
GKTFSMSSRLTKHRRIHTGEKPYECKQCGKTFRETSHLVYHQRIHTGEKPYECKLCGKTF
GETSSLTKHQRIHTGEKPYECKQCGKTFSVSSSLSVHQRIHTGEKPYECKQCGKTFSVSS
RLAGHQRVHTGEKPYECKQCGKTFSVSSSLAIHQRIHTGEKPYECKQCGKTFSVSSSLTK
HQRIHTGEKPYECKQCGKTFRETSHLVYHQRIHTGEKPYECKQCGKTFIVSYRLADHQRI
HTGEKPYECKQCGKTFSVSSSLTKHQRIHTGEKPYECKQCGKTFRESSSLSVHQRIHTGE
KPYECKQCGKTFSRSYRLTIHQRIHAVKKLKSICVEKQSQ
Download sequence
Identical sequences H9H749
ENSMODP00000022422 ENSMODP00000022422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]