SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022440 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022440
Domain Number 1 Region: 174-260
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.22e-30
Family Forkhead DNA-binding domain 0.00000987
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022440
Domain Number - Region: 140-157
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022440   Gene: ENSMODG00000017994   Transcript: ENSMODT00000022830
Sequence length 697
Comment pep:known_by_projection chromosome:BROADO5:2:373785565:373917542:1 gene:ENSMODG00000017994 transcript:ENSMODT00000022830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAPSSPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGEASADSMIPEE
EDDEEDDEGGCGVPGGGGGAGTAMAMGGASGVLGPGLRPEEAARLLAPSGQDSGAGAPPG
AGVLSGGQQAPLQPPQAPLPLPPPPPPPPLQQQQPPQQQGASGAAGQPRKCSSRRNAWGN
LSYADLITQAIESSPDKRLTLSQIYDWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSR
FKRVQNEGTGKSSWWMINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKASLQAAQE
APEDSPSSSSQLAKWPGSPTSRSSDELDTWTDFRSRTNSNASTISGRLSPILATSELDDV
QDDDPPLSPMLYSSSSSLSPSVSKPCTVELPRLTDMAGTMNLNDGLTDNLMDDLLDNITL
PPSQPSPSAGLMQRSSSFPYAAKGSGLGSPSGGFGNAVFGPSSLNSLRQSPMQTIQENKA
ATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAVSAQNSRRSVMLRSDPM
MSFAAQSGQGGLVAQNLLHQQHPAQSPLGGNRALSSAGGGLGLSDAGGLGSAKHQQPSPA
GQSMQTLSDSLSGSSLYSTSVNLPVMGHDKFPSDLDLDIFNGSLECDMESIIRSELMDAD
GLDFNFDSLISAQNVVTLNVGNFTGAKQASSQSWVPG
Download sequence
Identical sequences F7B7W4
ENSMODP00000022440 XP_001368493.1.35504 ENSMODP00000022440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]