SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022480 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022480
Domain Number 1 Region: 614-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 577-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 655-707
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000206
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 99-204
Classification Level Classification E-value
Superfamily SET domain 0.00000000000196
Family Histone lysine methyltransferases 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022480   Gene: ENSMODG00000018029   Transcript: ENSMODT00000022872
Sequence length 827
Comment pep:known_by_projection chromosome:BROADO5:2:370616655:370642265:1 gene:ENSMODG00000018029 transcript:ENSMODT00000022872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDFCLEKLVDTTLAATQCSSNTVNFPTLVEGTEGTMKMDMEDADMTLWTEADFEEKCTY
IVNDHPWDSGAEGGTAIQAEASLPRNLVFKYAPNCKEVIGVISKEYIPKGTRFGPLIGEI
YTNDTVPKNANRKYFWRIYSNGELHHFIDGFNEEKSNWMRYVNPAHSVQEQNLAACQNGM
NIYFYTIKPIPANQELLVWYCRDFAERLHYPSSGELMRMNLTQTHISPKQQSTEKNELYP
KSVPKREHSVKEILKNDSNHSKGKNFFHTNISPITPEKDMDNLRKNYSPERPICPRVIYP
IRVPNPEDLLKTSLTYRMERPTYITHSPIPSSTTPSPSAISSPDQSLKSSSPHGSLGDTV
SPLAPISQEHRESYSYLNTHYGTEGLGSYPGYIPPPSHLSPAFFPSYNTHYPKFLLPPYG
MGCNSLSTVNNINNISNFNIFPRLYPFYSNMLSGGGNLPPTVFNPATLPNSLPSEGSRRL
LQPEHPRDVLIPAPHSAFSITSAATSMKDKPCSPTSGSPTAGTAATSEHMIQPKATSAML
AANSSEEAMNLIKSKRNMTGYKTLPYPLKKQNGKIKYECNVCSKTFGQLSNLKVHLRVHS
GERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKP
YQCKLCPAKFTQFVHLKLHKRLHTRERPHKCTQCHKSYIHLCSLNVHLNGYCPLAPTSGL
PMEDLTRVNEEIEKFDISDNADRLEDAEDAADMTSVVEKEILALLRREMEGANLKMSLQR
NMGNGLISSGCNFYETSDPSLMKLPHSHPLPLLPVKVKQETVEPMDP
Download sequence
Identical sequences F6ZWK9
XP_003340522.1.35504 ENSMODP00000022480 13616.ENSMODP00000022480 ENSMODP00000022480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]