SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022552 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022552
Domain Number 1 Region: 580-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000392
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 617-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000139
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 96-126
Classification Level Classification E-value
Superfamily SET domain 0.00000785
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022552
Domain Number - Region: 138-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000482
Family Classic zinc finger, C2H2 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022552   Gene: ENSMODG00000018089   Transcript: ENSMODT00000022946
Sequence length 710
Comment pep:known_by_projection chromosome:BROADO5:2:361536364:361545561:1 gene:ENSMODG00000018089 transcript:ENSMODT00000022946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLYPEAAMHTNRAAAISVSAESCIPAGLRLGPVPGIFKLGKYLSDRREPGPKKKVRMVRG
ELVDESGGSPLEWIGLIRAARNTQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNS
LAQWFDIPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLHFHCVLSGGGGGRAFLHH
EHAARPTAAPTLDGFRLSPKPAAPELAVAAPAASLRNHSQGPPPPHQACGAREGIKREVS
SSTSPPPPGKLGASVKKTVGPGRGHGHFLGMVGGSPAGSGSLAFYPGARSAFKPTGLAKA
AAAAVAVHGTDSYREDNGAGAGKAGGGLGFGKFLGGVASGGGGHHHHHHHHSHHHAKCLH
TGPPPPPVLPCAGALRGFPLFSGHLEEASAFKHVERALPAGGLPSGRYAQVPPAAGLHLE
RFSLPPFEAGGLKSYPGECSHLPAVMPAFTVYNGELLYGSSTAAAAAAAYYPLKLHFGSL
LKYPESMSYFSGPAAAAAAAAAAAAAAAALNPGELGSLASIDREIAMHTQQLSEIAAEKS
RGRLDGALQPIGVPGGGGGGGGGSGGGGGSGVGGKPKTGHLCLYCGKLYSRKYGLKIHMR
THTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRH
PGQSVHAKASEEQDCTQGYPPEPGDPKSDNESDVDVCFTDDQSDQETGAQ
Download sequence
Identical sequences F7FT76
13616.ENSMODP00000022552 ENSMODP00000022552 ENSMODP00000022552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]