SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022572 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022572
Domain Number 1 Region: 351-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 313-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 252-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 399-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000069
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 5 Region: 222-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000506
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022572   Gene: ENSMODG00000018105   Transcript: ENSMODT00000022966
Sequence length 583
Comment pep:known_by_projection chromosome:BROADO5:8:108039450:108056249:-1 gene:ENSMODG00000018105 transcript:ENSMODT00000022966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESHFNSSPYFWPAVPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVP
LPSGISMDADTKPDQLTPHSQASVTQNITVVPVPSTGLMTAGREQKGSSQLLGPGLVITS
PSGSLVTTASSAQTFPISAPMIVSALPPGSQALQVVPDLSKKVASALAEEGGGGGGGGGG
GGSVASKPPRGRKKKRMQESGLPEMNDPYVLSPEDDEDHQKDGKTYRCRMCSLTFYSKSE
MQIHSKSHTETKPHKCPHCSKTFANSSYLAQHIRIHSGAKPYTCSYCQKAFRQLSHLQQH
TRIHSKLHTETVKPHKCPHCSKTFANSSYLAQHLRIHSGAKPYTCSYCQKAFRQLSHLQQ
HTRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKDKPFKCHNCHRAYTDAASLEVHL
STHTVKHAKVYTCSICSRAYTSETYLMKHMRKHNAPDLQQQQQQVSAVSAAAAAAAAVAQ
AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQASQASQQQQQQQQQQHFQPPGAAPQGGGGG
DSNPNPPPQCSFDLTSYKTAEHHKDICLTVTTSTIQVEHLASS
Download sequence
Identical sequences F7FFC8
13616.ENSMODP00000022572 ENSMODP00000022572 ENSMODP00000022572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]