SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022615 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022615
Domain Number 1 Region: 378-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.22e-19
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 342-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-18
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 4 Region: 244-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 281-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000526
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 6 Region: 420-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000705
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022615
Domain Number - Region: 146-169,196-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000631
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022615   Gene: ENSMODG00000018139   Transcript: ENSMODT00000023013
Sequence length 463
Comment pep:novel chromosome:BROADO5:2:356969433:356971014:1 gene:ENSMODG00000018139 transcript:ENSMODT00000023013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESQELVTCQDVAVDFTQEEWHLLNHSQKELYMEVMLENAQNSLLLGLLVPRESLISCFQS
EEVPWMRQSEGPRNSGPEIKFKVKEMERYPKSYYEFDEDGKSVRQYSFLIQCKKMIPRKD
CSQYGKYRETSNELIESHEKSPQVEVYQCTHYEMVFRSSSELIQYQKNHRTMLCTHNENR
KMTPKPKLLDNQILSTRKKACECNNCGTTCTDHSSLTDQPQFQNGKKPSADFLKHPEIYT
GDDPYKCNECGMAFSYRGSLAAHQRIHTGEKSYESHHCGKAFRSSSSLSCHQRIHRRKNF
MSNHCEKALTSNSSLINHQRTHNGEKLYECKQCGKFSHRNMFFSEHQRMHTGEKNYKCHP
RGKTFRCNSDLANHQKIHTGEKPYECNQCGKVFRRSSYLSRHQRVHTGEKPYESHHCGKA
FRSSSSLSCHQRIHRRKNFMSNHCEKALTSNSSLINHQRIHTG
Download sequence
Identical sequences F7CXQ3
ENSMODP00000022615 13616.ENSMODP00000022615 ENSMODP00000022615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]