SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022670 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022670
Domain Number 1 Region: 7-122
Classification Level Classification E-value
Superfamily POZ domain 1.18e-26
Family BTB/POZ domain 0.0021
Further Details:      
 
Domain Number 2 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-19
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 507-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-16
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022670
Domain Number - Region: 643-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000358
Family Classic zinc finger, C2H2 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022670   Gene: ENSMODG00000018181   Transcript: ENSMODT00000023068
Sequence length 672
Comment pep:known_by_projection chromosome:BROADO5:4:76189809:76253779:-1 gene:ENSMODG00000018181 transcript:ENSMODT00000023068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERIHSINLHNFSNSVLETLNEQRNRGHFCDVTVRIHGSMLRAHRCVLAAGSPFFQDKL
LLGYSDIEIPSVVSVQSVQKLIDFMYSGVLRVSQSEALQILTAASILQIKTVIDECTRIV
SQNVGDVYPVIQDSGQDTPRGTPESGTSGQSSDTESGYLQSHSQHSVDRIYSALYACSMQ
NGSGERSFYSGAVVSHHETALGLPRDHHMEDPSWITRIHERSQQMERYLSTTPETTHCRK
QPRPVRIQTLVGNIHIKQEMEDDYDYYGQQRVQILQHNESEECTEDTDQAEGTESEPKGE
SFDSGVSSSIGTEPDSVEQQFMAGLGREGPPEPSQTEPTDVPAEGGQPQPPPPPPPPQPD
ANSSSPERSNEVEMDSAVLTVSNSTEKVLQPSVNTSIAQPLPSTQLYLRQTETLTSNLRM
PLTLTSNTQVIGTAGNTYLPALFTTQTAGSGPKPFLFSLPQPLAGQQTQFVTVSQPGLST
FTAQLPAPQPLAPSAGHSTAGGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCS
ICWRSFSLKDYLIKHMVTHTGVRAYQCSICNKRFTQKSSLNVHMRLHRGEKSYECYICKK
KFSHKTLLERHVALHSASNGTPPTGTGPGARAGPTGVVACTEGTTYVCSVCPAKFDQIEH
FNDHMRMHVSDG
Download sequence
Identical sequences F7BTM3
XP_007493784.1.35504 ENSMODP00000022670 ENSMODP00000022670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]