SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022799 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000022799
Domain Number - Region: 71-80,222-249
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00288
Family Formin homology 2 domain (FH2 domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022799   Gene: ENSMODG00000018284   Transcript: ENSMODT00000023202
Sequence length 329
Comment pep:known_by_projection chromosome:BROADO5:2:346314928:346319102:1 gene:ENSMODG00000018284 transcript:ENSMODT00000023202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVASVPQREPLILGCRLAPLGFAPRAYFGHFPMMTAVPPPPFPRLPDPRALPPNLLLHF
LGDGRCRTPQPPAPAPPPPPLVPPGTCNPRAAPKKRRKKKVRPSPAGQLPSRYHQYQQHR
PSLEGGGSPSRAQGAPTPAPAAPVTPGPALGARAEEPASVATTGSLLPAATAASTPQPTR
KEVFKSKMGKSEKIIIPAGQLVHSIHLCEQPKINRQKSKCNIPLTKITSAKRNENNFWQD
SVASEIIQKQEKKPFKNTENIRNVNLKKSAFQTEVSQKENYAGAKFSDPPSPSVLPKPPS
HWMGSTFENSSQNRELMAVHLKTLLKVQA
Download sequence
Identical sequences F6Q6C4
XP_001367098.1.35504 ENSMODP00000022799 ENSMODP00000022799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]