SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022841 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022841
Domain Number 1 Region: 833-886
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000108
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 2374-2400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000161
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022841
Domain Number - Region: 894-943
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000148
Family Classic zinc finger, C2H2 0.053
Further Details:      
 
Domain Number - Region: 658-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000196
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 2059-2086
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000944
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 2288-2317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00125
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 791-819
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00437
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number - Region: 2230-2258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00483
Family Classic zinc finger, C2H2 0.0011
Further Details:      
 
Domain Number - Region: 1213-1238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00631
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 2017-2045
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0486
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022841   Gene: ENSMODG00000018319   Transcript: ENSMODT00000023246
Sequence length 2838
Comment pep:known_by_projection chromosome:BROADO5:2:343703808:343797238:1 gene:ENSMODG00000018319 transcript:ENSMODT00000023246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCQILICTSLGSHPWVPNGLFHSLSFALPLACTSLNRSQRLRTKPSRTSAPPAFSSVR
LREEKKAKPSSWSWRGWIFPPWGNHVVEARARLRSAPPHYGPRARSAGGARGAYATERGV
KMADEEADQESLSRSGGGCAAELQRLGERLQELERQLRESRGTAVEAATEYCQQLCQTLL
EYAEKWKTSEDPLPLLEVYTVAIQSYAKARPYLTSECENVALVLERLALSCVELLLCLPF
ELSDNQWKEFQALVQVAHKKLMENGSCELNFLANLAQETGVWKNPILHAILSQEPLDKEK
AFEGPILLDMRIKHLIKANQLSQATALAKLCSDHPEIGTKGSFKQTYLVCLSTSSPNDKL
IEEISAVDCKDALEMICNLESDGDEKSALVLCTAFLSRQLQQGDMYCAWELTLFWSKLQQ
RVEPSVQVYLERCRQLSLLTKTVYHIFFLIKVINSETEGAGLATCIELCVKALRLDSAEN
TEVKISICKTISCLLPEDLEVKRACQLSEFLLEPTVDAYYAVEMLYNQPDQKYDEENLPI
PNSLRCELLLVLKTQWPFDPEFWDWKTLKRQCLALMGEEASIVSSIDELNDSEVYEKVDD
YQGERKETSVNGLSGCFDEASSLLKGIRDEKEKKKEIKKLRERGFISARFRNWQAYMQYC
VLCDKEFLGHRIVRHAQKHYKDGVYSCPICAKNFNSKESFVPHVTLHVKQSSKERLAAMK
PLRRLGRPPKVPTTNQNQKTVAITKQEQRPIKKNSLYSADFIVFNDNDGSDDENDDKDKS
YEPVQKPIPVNEFTCPVAFCKKGFKYFKNLIAHVKGHKDNEEAKRFLEMQSKKVICQYCR
RHFVSVTHLNDHLQMHCGSKPYICIQIKCKAGFNSYAELLTHRKEHQVFRAKCMFPKCGR
IFSEAYLLYDHEAQHYNTYTCKFTSCGKVYRSQSELEKHLDDHNTEKVQAPEGQTNPSDE
SVQPSKVSENIDENIKNEKSVLPSENDTSNNLAVDGSSSWDQNKTESFVTEQGKISVSVL
GQTDTLLPDCSENPVIPFLSQNETNALTHSIKVSLSQGLQDNIVKQEKLAATGCMMNTDN
SVGTQLCTKVKDACNDSCLPGLQVRKENNCLNQGEHVQNTSANSDPLKIGDLAPQNLERQ
VNNLMTFTLQNQAVFQNNLPISKLEFEGNAKTTSGLYNLPLKTLEGITFVPPQPNLSSPL
VAPPVPPTAPVQKFCCQVEGCTRSYNSSQSIGKHMKTAHPDQYAAFKMQRKSKGRQRSSN
LNTPSEGKCVYFLPSQVNSNSNSVFTPQTKTSVKPTCSTQLPHVSTPLFPIHLENLSNPL
LPSMESVMSTNFPSHVKSEPGVLCAPMENCQTSIAIPLEDIAKTVLPLNIDSGSDPFLPL
PSESGSISLFPSPADNGTNSVFSQLENNTNHFSQVEGNTNAAFVKEESAPNTVFSSEVNT
ANSLSATTPQHPAPEKNKKDRGRGPNGKERKPKHNKRAKWPAIIRDGKFICSRCYRVFTN
PRSLGGHLSKRSYCKPLEGSEISQEALQSNGQSSLLANMILSTNAINVQQPPQPTFSSET
CFKDPSFLQLLTSENRASTFLQNTFPRSAVTNFNTTVNEEGSEIIKQALETAGITNTYEN
TEILSHMVPTTCVTDATQVNAAVIPNPDVSPLLQTVCHPNTLLTDQNRTLSTKTPSMNDC
SNLPVFPPDELLLKTVENGLCSGSFPSSVGSSQNFTTNSSRASVISGPQNVRASHLNKKG
NCASKRKRKAAPPLHENSPQNLGTNDLTAMGLLAKSIEGNAQTQTDNLQPQALVENLTQK
LNNVDNQLFMASIKENFKANLESHAALTPLAIKTENGDSQMMAMNSCTTSVNSDLQISED
SVIQNFEKTLEIIKTAMGSQILEVKNEIQDVIGASQNSQMSYNTQIPSVNIMQNSKMPDM
SQFSLQRDITTANGNSPKPEMPLKDDFQVLEILEGLQKLKLENDISVPLPGKVPQCLPVN
TSAPLVSTPVKAIPNTVVIQQTSEVGNNIQYSDKVNKPFVCQDQGCTYSAMTKDALFKHY
GKIHHYTAEMIMEIKKHQLKYAPFKCVVTTCPKTFTRNSNLRAHCQLVHHFTSEEMVKLK
IKRPYGKKSQNENVTATPQVVEIKKQTTLTVENKSEVQPPVEVEIQKEITINTVAMTAET
PLIEKKNPEKTESSPPTVTATPEQCDTHSCNNIEIKGRKNRRHKKEKEEIKHKKPETQSP
EVPTRYSPYRPYRCVHQGCFAAFTIQQNLILHYQAVHKSDLPVFPVEIEEESEACKESEE
TETKQTVKEFRCQVSDCSRIFQEVTSLLQHYMKLHEMTAEEIASMPPILDCGRFPCDQSH
CKSSFTTCLNYIIHLEMDHAVKFRPKKIEEDGIYKCDCEGCDRIYATRSNLLRHIFNKHN
DKHKAHLIRPRRLTPGQENISSKANQEKSRSKHRGTKHNRSGKEGSKASKNKRKKNIISE
NKNSKAEQVEENKPYSLKRGKHVYSIKARNDALSECTSRFVTQYPCMIKGCSSVVTSENN
IIRHYKCHKLSKSFTSQHRDLLIVFKQCCPAQVKDTSSEQEVDKKSDVKESDTCISESTN
DSSTTTVLQSEVEKDEMDELTELFITKLINEDSATVENQEDNTASSISTDIQENITCQSE
KQQSNNLKRASKEKAVSQNKKKKVEKPEEILAVEVNSMHKEEETAVAIQTTEEQPTTFDW
SSFKPMGFEVSFLKFLEESAVKQKKNTDKDHQNNGTKKGSHSNSRKSTDKTSFASGDHIW
TCSESETFVQFANPSQLQCSENVKIVLDKTLKDCTELVLKQLQEMKPTVSLKKLEVHSND
TNISGTKEISRGNENGEL
Download sequence
Identical sequences F6PTK6
ENSMODP00000022841 ENSMODP00000022841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]