SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022842 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022842
Domain Number 1 Region: 819-872
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000661
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 1565-1591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000107
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 880-929
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000859
Family Classic zinc finger, C2H2 0.053
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022842
Domain Number - Region: 663-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000138
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 1280-1307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000549
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 1479-1508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000727
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 1421-1449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0013
Family Classic zinc finger, C2H2 0.0011
Further Details:      
 
Domain Number - Region: 1059-1085
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0018
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 777-805
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00259
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number - Region: 1238-1266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0287
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022842   Gene: ENSMODG00000018319   Transcript: ENSMODT00000023247
Sequence length 2006
Comment pep:known_by_projection chromosome:BROADO5:2:343703808:343797226:1 gene:ENSMODG00000018319 transcript:ENSMODT00000023247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCQILICTSLGSHPWVPNGLFHSLSFALPLACTSLNRSQRLRTKPSRTSAPPAFSSVR
LREEKKAKPSSWSWRGWIFPPWGNHVVEARARLRSAPPHYGPRARSAGGARGAYATERGV
KMADEEADQESLSRSGGGCAAELQRLGERLQELERQLRESRGTAVEAATEYCQQLCQTLL
EYAEKWKTSEDPLPLLEVYTVAIQSYAKARPYLTSECENVALVLERLALSCVELLLCLPF
ELSDNQWKEFQALVQVAHKKLMENGSCELNFLANLAQETGVWKNPILHAILSQEPLDKEK
VNEFLAFEGPILLDMRIKHLIKANQLSQATALAKLCSDHPEIGTKGSFKQTYLVCLSTSS
PNDKLIEEISAVDCKDALEMICNLESDGDEKSALVLCTAFLSRQLQQGDMYCAWELTLFW
SKLQQRVEPSVQVYLERCRQLSLLTKTVYHIFFLIKVINSETEGAGLATCIELCVKALRL
DSAENTEVKISICKTISCLLPEDLEVKRACQLSEFLLEPTVDAYYAVEMLYNQPDQKYDE
ENLPIPNSLRCELLLVLKTQWPFDPEFWDWKTLKRQCLALMGEEASIVSSIDELNDSEVY
EKVDDYQGERKETSVNGLSGCFDEASSLLKGIRDEKEKKKEIKKLRERGFISARFRNWQA
YMQYCVLCDKEFLGHRIVRHAQKHYKDGVYSCPICAKNFNSKESFVPHVTLHVKQSIPTT
NQNQKTVAITKQEQRPIKKNSLYSADFIVFNDNDGSDDENDDKDKSYEPVQKPIPVNEFT
CPVAFCKKGFKYFKNLIAHVKGHKDNEEAKRFLEMQSKKVICQYCRRHFVSVTHLNDHLQ
MHCGSKPYICIQIKCKAGFNSYAELLTHRKEHQVFRAKCMFPKCGRIFSEAYLLYDHEAQ
HYNTYTCKFTSCGKVYRSQSELEKHLDDHNTEKPSKVSENIDENIKNEKSVLPSENDTSN
NLAVDGSSSWDQNKTESFVTEQGKISVSVLGQTDTLLPDCSENPVIPFLSQNETNALTHS
IKVSLSQGLQDNIVKQEKLAATGCMMNTDNSVGTQLCTKKFCCQVEGCTRSYNSSQSIGK
HMKTAHPDQYAAFKMQRKSKGRQRSSNLNTPSEGKCVYFLPSQVNSNSNSTVENGLCSGS
FPSSVGSSQNFTTNSSRASPEMPLKDDFQVLEILEGLQKLKLENDISVPLPGKVPQCLPV
NTSAPLVSTPVKAIPNTVVIQQTSEVGNNIQYSDKVNKPFVCQDQGCTYSAMTKDALFKH
YGKIHHYTAEMIMEIKKHQLKYAPFKCVVTTCPKTFTRNSNLRAHCQLVHHFTSEEMTTL
TVENKSEVQPPVEVEIQKEITINTVAMTAETPLIEKKNPEKTESSPPTVTATPEQCDTHS
CNNIEIKGRKNRRHKKEKEEIKHKKPETQSPEVPTRYSPYRPYRCVHQGCFAAFTIQQNL
ILHYQAVHKSDLPVFPVEIEEESEACKESEETETKQTVKEFRCQVSDCSRIFQEVTSLLQ
HYMKLHEMTAEEIASMPPILDCGRFPCDQSHCKSSFTTCLNYIIHLEMDHAVKFRPKKIE
EDGIYKCDCEGCDRIYATRSNLLRHIFNKHNDKHKAHLIRPRRLTPGTKHNRSGKEGSKA
SKNKRKKNIISENKNSKAEQVEENKPYSLKRGKHVYSIKARNDALSECTSRFVTQYPCMI
KGCSSVVTSENNIIRHYKCHKLSKSFTSQHRDLLIVFKQCCPAQVKDTSSEQEVDKKSDV
KESDTCISESTNDSSTTTVLQSEVEKDEMDELTELFITKLINEDSATVENQEDNTASSIS
TDIQENITCQSEKQQSNNLKRASKEKAVSQNKKKKVEKPEEILAVEVNSMHKEEETAVAI
QTTEEQPTTFDWSSFKPMGFEVSFLKFLEESAVKQKKNTDKDHQNNGTKKGSHSNSRKST
DKTSFASGDHIWTCSESETFVQFANPSQLQCSENVKIVLDKTLKDCTELVLKQLQEMKPT
VSLKKLEVHSNDTNISGTKEISRGNE
Download sequence
Identical sequences F6PTJ7
ENSMODP00000022842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]