SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022913 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022913
Domain Number 1 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 2 Region: 265-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000163
Family Classic zinc finger, C2H2 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022913   Gene: ENSMODG00000018374   Transcript: ENSMODT00000023318
Sequence length 839
Comment pep:known_by_projection chromosome:BROADO5:4:91286781:91383899:-1 gene:ENSMODG00000018374 transcript:ENSMODT00000023318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIEDKLEGLFLKCGGIDEMQSSRAMVVMGGVSDQSSVSGELQDAVLQDRSLPHQDILAA
DEVLQESEMRPQEMISHDELMVHEETVKNDDEMETQDRLPQGLQYAVNVPISVKQEITFT
DVAEQQKRDKKQIREPVDLQKKKKRKQRSPAKHFQQEGIEAYIDTLLAPPRYFNDGTQHL
PNISSALEFIMDSKERTILTINEDGSLGLKTPKSHVCEHCNAAFRTNYHLQRHVFIHTGE
KPFQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQKYHMERHKRTHSGEKPYQ
CEYCLQYFSRTDRVLKHKRMCHENRDKKPNRNATKGGLLTSEDDSGFSTPPKDSSLPKKK
RQKTEKKSSGMDKDSMMDKCDQKKDKNDYLPLYSSSTKVKDEYMVAEYAVEMPHSSVGGS
HLDDPASGEIHPPKLVLKKVNSKRSLKQPLEQSQTISPLSTYEDSKVSKYAFDLVDKQAL
LDSDGNPDIDQVDSLQEGPSKPVHSSTNYDDAMQFLKKKRYLQATSNNSREYALNVGTIA
SQPSVTQAAVASVIDESTTASILDSQALNVEIKSNHDKNVIPDEVLQTLLDHYSHKANGQ
HEISFNVADTEVTSSISINSSEVPEVTQPESVGTSSQASSSDKASMLQEYSKFLQQALDR
TSQNDAYLNNPSLNFVTDNQTLASQPAFSSIDKQVYAAMPINSFRSGMNSPLRTTPDKSH
FGLIVGDSQHSFPFSGDEANHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRP
QYHGTRAGMASQFSTANGQVNLRGPGTSAEFPEFPLVNVNDNRAGMTSSPDATTGQTFG
Download sequence
Identical sequences F6QVV7
ENSMODP00000022913 ENSMODP00000022913 XP_007493889.1.35504 XP_007493890.1.35504 XP_007493891.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]