SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023004 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023004
Domain Number 1 Region: 534-658
Classification Level Classification E-value
Superfamily Bromodomain 2.88e-37
Family Bromodomain 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023004
Domain Number - Region: 78-91,165-264
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00759
Family Formin homology 2 domain (FH2 domain) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023004   Gene: ENSMODG00000018448   Transcript: ENSMODT00000023413
Sequence length 1602
Comment pep:known_by_projection chromosome:BROADO5:8:120282054:120430594:1 gene:ENSMODG00000018448 transcript:ENSMODT00000023413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGAAAAAAAVEAAQAAGWVHARATAASHSSSRRRRRSPSRADLRAAAPSPCRPPPADA
QVEEQPQQQHQQQPQTPPPPPPPWEKPPPKPESRRCGGRRGTRGARSRRRGGREMCPEEG
AGEDAAGLGELRSWWEVPAIAHFCSLFRTAFRLPDFEIEELEAALHRDDVEFISDLIACL
LQGCYQRRDITPQTFHSYLEDIINYRWELEEGKPNPLREASFQDLPLRTRVEILHRLCDY
RLDADDVFDLLKGLDADSLRVEPLGEDSTGALYWYFYGTRMYKEDPVQGKSNGELASIKE
NGGQKSVPNMPGKTGKRRGRPPKRKKLQEEIALNEKQEENSTLAPLTRNGVQGPGHGTWW
LLCQTEEEWKQVTESFRERTSLRERQLYKLLSEDFLPEICNMIAQKEKRLHRTETELHPR
CMSDHLPIKSLKHEETPVLSRIEKQRRKEEEEERQILLAVQKKEQEQMLKEERKREMEEK
VKAVEDLCAVIFYCLQLIMLFIPSDRAKRRKLREERAWLLAQGKELPPELTHLDPSSPAR
EERKAKDLFELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKVPMDISSME
KKLNGGLYCTKEEFVNDMKTMFKNCLKYNGENSEYTKMSDNLERCFHRAMLKHFPGEDGD
TDDEFWIREDEKREKRKSRAGRGGSGSIWTRSRDTEGSNRRQQPLENGGKPLPPPHRASS
STDEQSSRTLQPPREVGPSNGRGFSHPLHFGGMPNQAPLLGQMRPAVPGTFGPLHGSDPV
NLYGSPRVPEPHPGEPVQQHQHFAMQPPVGLNEHRGPRLGVPEENQVCGGLTHFSTMGPH
PGSLQLGQMSGPSQDGNIYPPAQFQTGFIPPRHNGPPIRQEFSENSDVPPPGHMYRPYKY
LNRVHSSVWNGNHGTANQGPLGPEEKAPGGPGTSLQPRILGHIMDPRGIRSSLPPNQWTE
QSSFLPHGVPPSGYIRPPCKSTGQRLQQPPAQSSLFGGPSPALRGVQGGESMMDSPEMIA
MQQLSSRVCPPGVPYHPRQPPSPNLPGPFPQVAHSAAVTASTSKPALENNGSSQNINETK
EPDSKQGNYKPRLEEKPPSLGAPEGTYLTQLPHSKPPLQADCIRQGSPQHPETEVPIVKS
DSSQSGENCKATKGKNPWPTEGSYPSPTAQGCMRDLTTMAERGVLPENGIIGEASPCGSE
EKGLVGGGSSEKQLCPRNKTFQEAAIPCTGQNSNTSRNIDANLMGNAVNQFPPLYMPGLE
YSNSAAHYHINPGLQGFGPMMGGKQPPVSHPQHFPPRNFQPSNSHSAVFPRYRPHQGIQY
SYQPPPQPSFHHYQRTPYYTCPQGYSDWQRPLHPQGNQPGHPAHQAPPPRPPFSDKGTVS
SLQGCEALNATLASPTRIAVVGAKVVSTDGQNLGPKEEKSDESIERPESPKEFLDLDNHN
AATKRQNCVPANEFLYGSPSPALSSGMNFSSSTFPPHSMMLQSGPPYTSQHTASHFQPRA
YSPVSAHPSHPAAAQPNGLPQEGPLYRCQEENMGHFQAIMMEQRGNISGMGGPFQDLYRS
SGMQMHQTQAQSQSPFPKVSAPTSTRKELPPQKPSVLPLDQS
Download sequence
Identical sequences F7CUF2
ENSMODP00000023004 ENSMODP00000023004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]