SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023100 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023100
Domain Number 1 Region: 45-93
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000636
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023100
Domain Number - Region: 1272-1280
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0497
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023100   Gene: ENSMODG00000018525   Transcript: ENSMODT00000023512
Sequence length 1440
Comment pep:novel chromosome:BROADO5:8:122974221:123029257:1 gene:ENSMODG00000018525 transcript:ENSMODT00000023512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPYQEEMKKKNNISNEGDEEHKDTEGEENRMGPHFVVIPYEEADRCPICLSCIIEKEVGF
PENCNHIFCITCILKWAETLPSCPIDRKPFQAIYKFSASEGCIKVQVPRQLRETDDKKCE
CSFKKQDCHSVNIKSCTRKRADVKRDLLSAEFYKDLKKMHKNTSNNEMVNRKATLIKVNK
PQRQNCPNHWFRNYFSSVFSSDNHIGESSCTVRRFPEVTEIDSMIRQKRQELQLSWFPDT
LPGVARVGFIPWMAGAEIIPLVSSMLPGTIFPMNTISLEDFGSICKEHVLAHTQGGEEKK
QTSGTSNSRGTRRKPAETTPRRRSTRNMKSETVSQSQNSPISNNSEYDAPDSKNSSINVS
TSADSKKQIRPIPKRKPKRRTRKAPVVKKKLRSSSSLPEKSSSSDSADEEVVESDTLPVL
DKEYISNTESCSSCIMQPDIEQESANGLGSLNEHVDIEELNENHGKELDTVEKSFSDSGN
QEPSLLVEEEIKEIENKSTEEDTLFLESELSKNNTEKVDEPMETQVKISEHLEFELKADA
TLESTQNELPTNSKSEGDVYQVHTSFKDEVFESSESKVNEDQCTESLKVNTLGHIDSEIK
VLCVQSSAVESLEQEEALLVEDHVPESPKVDLLDHTESGELDSPGNEESTIVYSDNEHLK
SIQESKNLLKDDLSDDDKVNKSVEEKSEFLDEENKNIESSNLDSEQLPKHFNEDNNETIP
MECDSFCSDQNESESELAISAKTNLEENSQDKTQDSDLKSGKDATLTHETENSAHLVDKA
KKPRTRRSRFHSPSTTWSPSKDIIRERKRSQSQSPKKDIGKESRKSHSQSPKMEITRGRR
RSRSQSRSPKRDVARERKRSQSWSPKREEGRKSQSLSPRRDSSREGRRSQSRTKDSSPKE
KSRSRSRERENDRDGQRRDRVRERRARRWSRSRSRSRSCSRSRTKSSKASFSRNDRDSYS
PRWKERWTNDNWRFPRGNDRYRKNEQDKQNENMKKEKNEVNPDTDEQCSADKHKNDCPDW
IMERINSGQDPRTRNTEKFKDSHWEENRHDNSGKSWNKNFGSSWMSSRGRGNRGRSTFRA
GFGHNEQNENRWQNRKPLSGNSNSSGNESSKFVEQQSYRRKSEQEFSFDTPADRSGWTSA
SSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMRQEEETPEQDQNLKDQTNQQGDGTQLPI
TMMPQQMNVMQQQMNAQHQTMNIFPYTVGVHAPLMNIQRNPFNIHPQLPMHLHTGVPLMQ
VAAPANVSQGLPPPPPPPPPSQQVNYIASQPDGKQSQGIPSASHVGNNTSTPVLPAPTAT
PGNMGTFQGPSSGNASSSSHSKAPNAAVKLAESKKLQIQEKAAQEVKLAIKPFYQNKDIT
KEEYKEIVRKAVDKVCHSKSGEVNSAKVANLVKAYVDKYKHSRKGSQKKNPEEPASTEKK
Download sequence
Identical sequences F7GL53
ENSMODP00000023100 13616.ENSMODP00000023100 ENSMODP00000023100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]