SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023223 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023223
Domain Number 1 Region: 410-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 153-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 354-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.75e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 24-76
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.28e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 209-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 100-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-19
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 315-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 67-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000292
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023223   Gene: ENSMODG00000018622   Transcript: ENSMODT00000023637
Sequence length 483
Comment pep:novel chromosome:BROADO5:Un:52341197:52343110:-1 gene:ENSMODG00000018622 transcript:ENSMODT00000023637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSNKVEEMKIFHPSSYRPDVQRVHTGKKPYHCKVCDKRFKDKSHLQIHQRVHTGEKPYHC
KVCDKRFSIKSNLLVHQRVHTKEKPYQCDECGKCFSQRDNSHLQIHQAVHTEEKPFHCKE
CGKSFRYNSGFQIHQKVHTGEKPHHCKECDKRFKDNSSFQIHQRIHTGEKPYHCKVCDKR
FSIKSNLHVHQRVHTGEKPYQCDECGKCFSQKSHLHTHQRIHMNEKPYQCQVCDKRFRSH
YNLYFHHRLHTGEKPYHCSKCGKCFGRPSTLHAHQKVHTGEKPFQCNECGKCFSQRAYLK
AHLRIHKGEKPFQQKSFQCKVCGKTFRKNSALQSHQKVHTEEKPFQCKECGRQFKNESNL
HVHQKAHKGEKPYHCKECDKSFRYNSILQIHQRVHTGEKPYHCKECDKRFKDNSNLQIHQ
RVHTGEKPYHCKVCDKKFSIKSNLQVHQRIHTGEKPYQCDECGKCFSQKSHLHTHQRLHN
RIR
Download sequence
Identical sequences H9H755
13616.ENSMODP00000023223 ENSMODP00000023223 ENSMODP00000023223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]