SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023240 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023240
Domain Number 1 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-26
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.67e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 9-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 446-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 150-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000804
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023240   Gene: ENSMODG00000022740   Transcript: ENSMODT00000023654
Sequence length 512
Comment pep:novel chromosome:BROADO5:Un:41477616:41494299:1 gene:ENSMODG00000022740 transcript:ENSMODT00000023654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGSPGLQAQEAVTFRDVAVDFSQEEWRLLAPPQKELYKEVMLENAQNLLSLGFLQFSH
SQCPGLPVPREDLISYLEQREAPWIREQEGRRSCCPEGEIRPKWKEPPTEPVFSLEGTHK
QRFMNDGPWYVTWREFWAEYQRILNKEKAHKAFGQQSSCIYHQKTDTEKKLHKCHACPET
FNKQSSLIRHQRIHTEEKPYECHQCGKAFGQRVSLAQHQRIHTGEKIFKCHHCGKAFGQQ
SSLIYHQKTHIGKKTHECHECSKAFSEHSSLIRHQRIHSGEKPHECRQCGKAFIQRASLV
QHQRIHSGEKPYKCTQCGKTFTVSSSLALHQRIHTGEKPYECNQCRKTFTNCSNLVLHQR
IHTGEKPYECSQCGKTFTTSSHLARHQRIHTGEKPYECNQCGKTFAQSSNLAGHQRIHSG
EKPYECKQCGRTFTLSSHLARHQRIHSGEKPYTCNQCRKTFTLSSSLAQHQRIHIGEKPY
EYSQCRKTFTLSFHFVPHQKIHTGVNLKNNSQ
Download sequence
Identical sequences H9H758
XP_007506375.1.35504 ENSMODP00000023240 ENSMODP00000023240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]