SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023378 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023378
Domain Number 1 Region: 81-174
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000209
Family Double-stranded RNA-binding domain (dsRBD) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023378
Domain Number - Region: 45-57
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000366
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023378   Gene: ENSMODG00000018753   Transcript: ENSMODT00000023794
Sequence length 339
Comment pep:known_by_projection chromosome:BROADO5:2:494387444:494401445:-1 gene:ENSMODG00000018753 transcript:ENSMODT00000023794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METMRAQRLQPGVGGGGGGIGTLRALRPGVTGAAAAASSPPGGPPPAPPPPAPPPPPLLL
SGAAGLPLPPGAAGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADL
KNGALVVYEMVPSNSPPYVCYVTLPGGSCFGSFQFCPTKAEARRSAAKIALMNSVFNEHP
SRRITDDFIEKSVSEALASFNGNREEADNPNTGIGAFRFMLESNKGKSMLEFQELMTVFQ
LLHWNGSLKAMRERQCSRQEVLAHYSHRALDDDIRHQMALDWVSREQGVPGALSRELAST
ERELDEARLAGKELRFHKEKKDILMLAAGQLGTMHSSNC
Download sequence
Identical sequences F7EF18
ENSMODP00000023378 ENSMODP00000023378 13616.ENSMODP00000023378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]