SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023474 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023474
Domain Number 1 Region: 788-985,1328-1405
Classification Level Classification E-value
Superfamily SET domain 6.15e-78
Family Histone lysine methyltransferases 0.00025
Further Details:      
 
Domain Number 2 Region: 720-794
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000134
Family Methyl-CpG-binding domain, MBD 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023474
Domain Number - Region: 396-447
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00451
Family Tudor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023474   Gene: ENSMODG00000018821   Transcript: ENSMODT00000023890
Sequence length 1407
Comment pep:known_by_projection chromosome:BROADO5:2:496097569:496125635:1 gene:ENSMODG00000018821 transcript:ENSMODT00000023890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFAPLGCTAGEAASPLSQATPLRRLPPPLFPLALQPPPPRRLRLPTRGGNPPPPSSVVA
VLEADAPPAQFDLSRPPSPRPEEYVGHTSGVRPALRSPSHHSFPPTPRSILPFPHPPSLG
FPRSPRRCRPRGRTSGMTSFPGCFGLGTAAAAGMEPQEIAELQQAVVEELGISMEELRQF
IDEELEKMDCVKQRKKQLAELETWVVQKESEVAHVDQLFDEASRAVTNCESLVKDFYSKL
GLQYRESSSEDEASKPTEVIEIPDEDDDVLSVDSGDAGSRTPKDQKLREAMAALRKSAQD
VQKFMDAVNKKTSSQDLSKGALGQVPIELSKDGDLVVNMRILGKKRTKTWHKGTLIAIQT
VGAGRKFKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAE
TPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNR
PMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKT
STASTLEKKQGGQLRTRPNMGAVRSKGPVVQYTQDLTGTGTQFKPLEPPQTTSLPAPTLS
PQVTELESLESQLAQARKQVAKKSTSFRLGSVGSGHSSPTSPGLSEVVPGGKSGVTQTIR
LPPGSATSAPTFPAFHGMLERAPTEPSYRAPMEKLFYLPHACSHTCLTRVRPVSNAQYRG
KNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMNEIERYLFETSCDFLFLE
MFCLDPYVLVDRKFQPYKPFYYILDITHGQEDVPLSCVNEIDTTPPPQVAYSKERIPGKG
VFINTGWDFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQHKRLDECLPT
GVYECNKRCKCNLNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIARGSFVCIYAGKI
LTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTE
DPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETASKDSRPTESGPPH
FSAPTSTSVGGCKPPSSEETPKNKVATWLSCNNISDGSFADSDSRSSFRTSEGGDGKAGG
GRGDGEKPSTSGLGVKEEGDIKPSKKEESDEQNKILLPSEGSRTFGYNPSPVKTEGIKRP
PSKTNMHQNRRLMGPAQPNPDDVLTLSSSTESEGESGTSRKPLAGQTPATAADSDDIQTI
SSGSDGEDFEDKKNLSGPVKRQVAVKSTRGFALKSTHGIAIKSTNMASADKGESVPVRKN
TRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIR
AGTELTWDYNYEVGSVEGKELLCCCGP
Download sequence
Identical sequences F6YYP8
ENSMODP00000023474 ENSMODP00000023474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]