SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023533 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023533
Domain Number 1 Region: 450-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 3-59
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.28e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 47-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 296-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.34e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 494-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 114-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 195-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 363-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.65e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 9 Region: 258-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.44e-18
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 10 Region: 582-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 412-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000682
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 550-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000103
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023533
Domain Number - Region: 162-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0005
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023533   Gene: ENSMODG00000018860   Transcript: ENSMODT00000023951
Sequence length 639
Comment pep:novel chromosome:BROADO5:Un:43479837:43537457:-1 gene:ENSMODG00000018860 transcript:ENSMODT00000023951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVFNDGSSHTKHQRIHTGEKPYKCSDCGTSFIDSSSLAQHQRIHTGVKPYKCYECGAAFT
QSSLSPHQRIHTGENPFNCNECGKAFRQNVFLILHQRMHTGEKPYEWSGRGKAFGDSSSF
TKHQSIHTGEKPNKCNDCRKSFSDSSSFTRHQRIHTGEKPYKCTCGKSFSDSSSLSHHQR
IHPREKFKCNECGYTFRQNALLVLHLRVHTGEKPYECSRCGKAFSSSSSLMKHQRIRIGP
KSYKFIDCGKSFSDSLSSQHQKIHTEEKPYQCNYDCGTSFIDSSSLAQHQRIHTGVKPYK
CYECGAAFTQSSLSPHQRIHTGENPFNCNECGKAFRQNVFLILHQRMHTGEKPYEWSGRG
KAFGDSSSFTKHQSIHTGEKPNKCNDCRKSFSDSSSFTRHQRIHTGEKPYKWKHYKCKEC
GKVLSKFHLKPHQRVDTGEKPYECNECGKAFNDGSSLTKHQRIHTGEKPYKCSDCGTSFI
DSLSLAQHQRIHTGEKPYKCSECGAAFTHTLGDSSSFTKHQSIHTGEKPNKCNDCRKSFS
DSSSFTRHQRIHTGEKPYKCTCGKSFSDSSSLSHHQRIHPGKPFKFNECGYTFRQNAYLV
LHLRVHTGEKPYECSRCSKAFSSSSSLMKHQRIRIGPKS
Download sequence
Identical sequences H9H783
ENSMODP00000023533 13616.ENSMODP00000023533 ENSMODP00000023533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]