SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023535 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023535
Domain Number 1 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 604-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 103-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 660-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 380-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 48-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 9 Region: 716-771
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 269-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 11 Region: 436-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 12 Region: 159-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 13 Region: 212-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.38e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 14 Region: 1-48
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.45e-17
Family Classic zinc finger, C2H2 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023535   Gene: ENSMODG00000019980   Transcript: ENSMODT00000023953
Sequence length 772
Comment pep:novel chromosome:BROADO5:4:413286874:413303516:1 gene:ENSMODG00000019980 transcript:ENSMODT00000023953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HQRIHVGENPYECNDCGKGFHHRSKLNIHRRAHTRKNPYQCNDCGKMFINDSKHILHQRI
HTGEKPFKCNDCGKAFNQNSNLLQHQRIHTGEKPFKCDDCGKAFNQNSHLLQHQRIHTGE
KPFQCHDCGKAFNQWSHLLQHQRIHTGEKPFKCNDCGKAFSQRSKLNVHQRIHTGEKPFQ
CHDCGKAFSQRSKLIIHQRIHTDEKPFKCNDSFNKSSKLILHQRIHVGENPYECNVCGKG
FHHRSKLNIHQRAHTRKNPYQCNDCGKMFINDSKLILHQSIHTGEKPFKCNDCGKVFSHR
SKFIIHQRIHTGEKPFKCDDCGKAFIRSSTLLQHQRIHTGEKPFKCDDCGKAFNQNSNLH
QHQRIHTGEKPFKCNDCGKVFNQISHLLQHQRIHTGEKPFQCHDCGKAFNQNSNLHQHQR
IHTGEKPFKCNDCEKAFNRSSTLLKHQRIHTVEKPFQCHDCGKAFNQNSHLLQHQRIHTG
EKPFQCHDCGKAFNQNSHLLQHQRIHTGEKPFKCDDCGKAFNWISSLRKHQRIHTGQKPF
QCNDCGKTFNQNSNLSVHQRIHTSERPFQCNDCGKAFIRSSTLLQHQRIHTGEKPFKCHD
CGKAFNQNSHLLQHQRIHTGDKPFKCDDCGKAFNQNSNLHQHQRIHTGEKPFKCNDCGKA
FNQISHLLQHQRIHTGEKPFQCHDCGKAFNQISHLLQHQRIHTGEKPFQCHDCGKAFNQN
SNLHQHQRIHTGEKPFKCNDCEKAFNQSSNLLKHQRIHTGEKPFQCHDCGKA
Download sequence
Identical sequences F7DVG2
ENSMODP00000023535 ENSMODP00000023535 13616.ENSMODP00000023535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]