SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023538 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023538
Domain Number 1 Region: 185-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-26
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 130-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.28e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 339-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.22e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 74-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.32e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 31-83
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000131
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023538   Gene: ENSMODG00000028236   Transcript: ENSMODT00000023956
Sequence length 403
Comment pep:novel chromosome:BROADO5:4:413466065:413467276:-1 gene:ENSMODG00000028236 transcript:ENSMODT00000023956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTNSVEKSEKPGVTFGAFHLYSFQKSTNMYTGEKFYKCPQCRKAFNKSSKLILHHRIHV
GENPCECNVCGKGFHHRSKLNIHRRAHTRKNPYQCNDCGKMFINDSKLILHQRIHTGEKP
FKCNDCGKFFSHRSKLIIHQRIHTGEKPFKCHDCGKAFIRSSHLLQHQRIHTDEKPFKCD
DCGKAFNQNSNLLQHQRIHTGEKPFKCDDCGKAFNRNSNLLQHQRIHTGEKPFQCNDCGK
TFNQNSNLSVHQRIHTSERPFQCNDCGKAFNRSSHLLQHQRIHTGEKPFQCHDCGKAFSQ
SSYLLQHQRIHTDEKPFKCDNCGKAFNQNSNLSVHQRIHTGEKPFQCHDCGKAFNQSSHL
FQHQRIHTGEKPFKCNDCGKVFNQSSNLIVHQRIHTGKLIKKS
Download sequence
Identical sequences F7DVE3
ENSMODP00000023538 ENSMODP00000023538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]