SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023550 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023550
Domain Number 1 Region: 1020-1074
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000152
Family Centromere-binding 0.022
Further Details:      
 
Domain Number 2 Region: 562-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000087
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023550
Domain Number - Region: 614-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00135
Family Classic zinc finger, C2H2 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023550   Gene: ENSMODG00000018875   Transcript: ENSMODT00000023968
Sequence length 1409
Comment pep:known_by_projection chromosome:BROADO5:2:496599285:496657330:-1 gene:ENSMODG00000018875 transcript:ENSMODT00000023968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTATVSVSLQPISAPVPIVAHAS
VGGHLSTSTTVSSSGAQNSDSAKKTLVTLIANNNAGNPLVQQGGQPLILTQNPASGLSTM
VTQPVLRPVQVMQNANHVTSSPVTSQPIFITTQGFPVRNVRPVQNAMNQVGIVLNVQQGQ
TVRPITLVPAPGTQFVKPTVGVPQVFSQMTQVRPGSTMPVRPTTNTFTTVIPATLTIRST
VPQSQSQQTKSTPSTSTTPTATQPTSLGQLAVQPPGQSSQAPNPKLAPSFPSPPAVSIVS
FVTVKRPGVTGENSNEVAKLVNTLNTIPSLGQSPGPMVVSNNSPAHSSQRTSGPEASALK
VTSPVLTFDLQDGGRKVCPRCNSQFRVTEALRGHMCYCCPELVDFLKKGKSLDPEPNIPS
AAKPPSPEKTAPMPSTPSSTPAPTLSPPSKAPEPMENSGDVTQSKLIMLVDDFYYGRDSG
RVSQLLNFPKVPTSFRCPHCTKRLKNNIRFMNHMKHHVELDQQNGEVDVHTICQHCYRQF
TTPFQLQCHLENVHSPYESTTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRS
SLYSEVDGHFRMIHEDTRHLLCPYCLKVFKNGNAFQQHFMRHQKKSVYHCNKCRLQFLFA
KDKIEHKLQHHKTFRKPKQLEGLKPGTKVTIRASRGQPRTLPMSSNDAPPNALQEAAPLT
TPADPVPIFLYPPLQRSIPKKAVKKMSVMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYS
TCCSRAYANHMINNHVPRKSPKYLALFKNSSVSGIKLACTSCVFVTSVGDAMAKHLVFNP
SHQSSNVLPRGLTWISHSRHGQAHDRGMKNTYPSAFPHNKVATVKSVGASPGSGETPISQ
VQLLSAPSAALTAPSAPGCPQTPAAPPLHTEGSEGLSLDEQDEGALAMSEPEPATAGGLG
GAGKKEQLSVKKLRVVLFALCCNTEQAAEHFRNPQRRIRRWLRRFQASQGENLEGKYLSL
EAEEKLAEWVLTQREQQLPVNEETLFQKATKIGRSLEGGFKISYEWAVRFMLRHHLTPHA
RRAVAHTLPKEVAENAGLFIEFVQRQIHTQDLPLSMIVAVDEISLFLDAEVLSSDDRKEN
ALQTVGTGEPWCDVVLSILADGTVLPTLVFYRGQMEQPTNVPESILLEAKESGYSDDEIM
ELWSSRVWQKHTACQRSKGMLVMDCHRTHLSEEVLSMLSSYSTLPAVVPAGCSSKIQPLD
VCIKRTVKNFIHKKWKEQAREMADGTCDSDILLQLVLCWLAEVLEVIGDCPELVQQSFLV
ASVLPGPDGTANSPTRNADMQEELIASLEEHLKLNGEQTEEEPSASTPQSRPSPEEVTEP
ESLHQLFEGESETESFYGFEEADLDLMEI
Download sequence
Identical sequences F7DA93
XP_007485488.1.35504 XP_007485489.1.35504 13616.ENSMODP00000023550 ENSMODP00000023550 ENSMODP00000023550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]