SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023567 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023567
Domain Number 1 Region: 501-594
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.2e-21
Family Tudor domain 0.0041
Further Details:      
 
Domain Number 2 Region: 785-878
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.52e-21
Family Tudor domain 0.0032
Further Details:      
 
Domain Number 3 Region: 1004-1095
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.45e-18
Family Tudor domain 0.0051
Further Details:      
 
Domain Number 4 Region: 1589-1661
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.85e-17
Family Tudor domain 0.0076
Further Details:      
 
Domain Number 5 Region: 295-373
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000286
Family Tudor domain 0.0063
Further Details:      
 
Domain Number 6 Region: 1304-1398
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000647
Family Tudor domain 0.0083
Further Details:      
 
Domain Number 7 Region: 41-134
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000903
Family Tudor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023567
Domain Number - Region: 553-660
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000275
Family Staphylococcal nuclease 0.021
Further Details:      
 
Domain Number - Region: 1481-1621
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000759
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 2031-2094
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.012
Family Tudor domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023567   Gene: ENSMODG00000018889   Transcript: ENSMODT00000023986
Sequence length 2138
Comment pep:known_by_projection chromosome:BROADO5:2:292648197:292659030:1 gene:ENSMODG00000018889 transcript:ENSMODT00000023986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTPGMPSPGAPITLRVSFVDVHPEVIPVQLWGLVGDRREEYVRLGHDIQVAAAAVAAR
TRAMPAANPGELCLVQLGPRWHRCRVVSRQAQECRVFLLDEGRTVTANSAALAPGRNEFF
HLPSEVLGCVLTGLVPLGGGGGEPQQWSRGAVDFLGHLQGKEVQGRVQDVLLPQRLVLLE
VPTVFQQMQDLGLARQVPDSLFRSLLKRYINAAGASVLLPRALPKQDPPQLLDYFYPQLQ
LGVTEPVVVTQVCHPHRIHCQLRSLSQEIRRLSDSMAHAYRATGTGDESGRNSSWEEREE
SPDKPGSPCAACGLDGQWYRAQLLENFRPQRCAQVLHVDYGRKELVSCGSLRYLLPEYFR
MPVVTYPCALYGLWDGGRGWSRSQVGDLKALILGQAVNAKIEFYSSFEHVYYVTLYGEDG
INLNCAFGVQSCCLADRLLQSPGLEEEEGKESEPEEGLEDDLSPPVLKAVRLKANSFYDA
QVEFVKDPSEFWIRLRKHSGPFSKLMRSMCNFYSSRKLDGLSLQPVPDHLCCAKWKEHGY
YRAVVTRLVGDKSVEVHLVDRGDTETVGCSDVKMLLPQFRQLPAVALRCCLADIWPLGET
WSREAISYFKKTVLHKELVIHVLDKQDSQYVIEILDESRMGEENVSKLIAQAGYAKYQEF
EMMDIRPPAHSPGQIPNQLNTDCNRVASAKKVGMGQWVMKDDKPPVSEVGTDRTVVTKSS
FSESVVQAAEKTRNMPIYSPLVQNYLEIKPGSPCKGQLEVGSTVEVKVSYVESPGYFWCQ
LTRNLQGLRTLMCKIQDFCKNSAPLYQGISPACLAKRTINGKWSRALIISGTPSTDHAKV
IFVDYGNKEIVSMKNIYSINDDFLKLKAQAFRCSLYNLIQPASQNPFVWDERAIQAFKEF
VDNAWEDNLELKCTIFALAAINNKELFNVVDLLTPFQSACHYLTEIGFAKQVQLQKPLAS
SMQLHSYYYSTHDIKIGSEEAVFVTHVDGPWTFYCQLSRSSGVLEQLSSDICRLSKVLQH
SKTSSLNPGTLCLAKYSDQNWYRGIVTGKEPNKVFFVDFGNVHVVANEDLLPIPGDAYDL
LLLPMQAVKCSLSDVYDNTPKEIAGWFEEAVLDKSLKALVVAKDPDGRLIIELYDGSVQI
NAKINEKLGLLGFKGPKKVENEELLSSAETFKEVKSENRNLLAGYSSKTANKLCTSEIQG
ESCKPKISLACKELKNLQSSTKIGLLTHYQESVGGQSNHVSHPPNKIGENLVQPSVQVLE
RNKDLPLKFCDLPQKSIVPGFKTKVYVSHINDLTDFYIQLADDEEELASISEKLNDDKTR
RECFARRSLAKGDLICAVFPEDDLKYRAVVKEQSGDLVTVQFIDYGNTSVVNISKLSKLQ
KANALVPGMGIHCTLGGLHILQIKNQCQELYFSERTGEAQINCEFVMKYEDKWDVLLTDE
QGVISEDMISKFISNGKSQVETSAQVNAGTNLETLLDPPPPPPPPPVPPPPPPPPPLSLP
LPLLLPLPPHLPLPHLPPPPQDPFKDPGKKNFKLRNWYLPEVNKIKVYATVIDGPEYFWC
QFADTKVLDCLDPQVQAAGEHAAVCADCISGVQSGVACIVKYSEDGRFYRGLVTDVLEGD
LVSVRLVDFGNAVNFSRNAIWNIPSDLLNVNMQCFPCCLSGYNVLEGICSFEENDYFYEI
ATEGILELTILEIKKDVCDIPLAVVQLKYEGENLNEKMLKFSEQFCTTDEEFSKTLCENK
LREAETPRSLSLAIGNKPNKVVQDGLLYMESQGDIFRLSSGLNHVETKPSLAFESETIAA
FVSSAGPLGKDNVGDNRIECSLAEKVKFDSDKNLITGLETLLPRINETKEILELDSLEVP
LSMEESKEFLELESIELQLSLAGDEAKELDLEPPMAHLSQGCDPKVVTLEQFTIQLSNNS
KSEQLELESPIGSLSLDKETQPFSKVSQKAQETPCPEDSGEPNHLKPFDRCKVHSKTETA
HNLYKEVFTEYKNRLSVESLTHLLPEEEIKAEENHGNALTDHASAQIENTYTLEGFTIGS
KCVVWSSIRNTWSECQILEIADEGTKVLNLSNGMEEIVNPENVWNGIPKLNNSPSEGVYQ
ALEKDFYLNSTDDTAIKALGFTPLVLEKRAGGDLSVEP
Download sequence
Identical sequences F7CR83
ENSMODP00000023567 ENSMODP00000023567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]