SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023632 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023632
Domain Number 1 Region: 527-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.85e-19
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.59e-17
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 4 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000146
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 5 Region: 321-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000253
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 569-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000592
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 7 Region: 167-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000179
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 8 Region: 248-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000239
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 9 Region: 20-125
Classification Level Classification E-value
Superfamily SET domain 0.0000719
Family Histone lysine methyltransferases 0.048
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023632
Domain Number - Region: 230-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000696
Family Classic zinc finger, C2H2 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023632   Gene: ENSMODG00000018942   Transcript: ENSMODT00000024052
Sequence length 632
Comment pep:known_by_projection chromosome:BROADO5:5:8968535:9238929:1 gene:ENSMODG00000018942 transcript:ENSMODT00000024052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGMYVPDRFALKSSQVQDGMGLYTARRVRKGEKFGPFAGEKKMPQNLNESTDYRLMWEV
CGSKGQVLYVLDASNPRFSNWLRFVHQAPTPEQKNLAAIQDGENIFYLAVEDIDTDTELL
VGYLDSDMEEEEEEEEEVEETTMNKETHGKHIRKTPCHMKEPSSCKKDHACPHCESSFAS
QEILAEHLQMLHQKPSEEKEFKCKNCGKKFPVKQALQRHILHCMEKTSPGDSLKTFHCYV
CNTSLCSESSLEQHREACQGDPQFICKADGCGKRFRSKDALKKHKENIHVGNPRKKLICT
VCSKKCSSLSTLQEHRKVHEIFECQECNKKFITPNQLKRHMITHSEKRPYNCEVCNKSFK
RIDQVAAHKIIHSEDKPYKCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFS
LQRHLLIHNSERTFKCDQCDATFKRKDTLNVHIQVVHDGHKKYKCDLCDKAFVTPSVLKS
HKKTHTGEKEKICPYCGQKFASNGTLRVHIRSHTGERPYQCPYCDKAFSKNDGLKMHIRT
HTREKPYQCTQCNKAFSQKRGLDEHMRTHTGEKPFQCDVCDLSFSLKKMLIRHKLTHNPN
RPMAECPFCHKKFTRNDYLKVHMENVHGEADS
Download sequence
Identical sequences F7GB24
ENSMODP00000023632 ENSMODP00000023632 XP_003341412.1.35504 XP_007495604.1.35504 XP_007495605.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]