SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023704 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023704
Domain Number 1 Region: 111-198
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000012
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 38-113
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023704
Domain Number - Region: 265-270
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0262
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023704   Gene: ENSMODG00000018992   Transcript: ENSMODT00000024126
Sequence length 396
Comment pep:novel chromosome:BROADO5:5:12207982:12211347:1 gene:ENSMODG00000018992 transcript:ENSMODT00000024126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQHYKGSDFD
CELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVE
CIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRM
PPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYD
RRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQVEYHEFTGGSGYDYSYAGGR
GSYGDLGGPIITTQVTIPKDEHRTRYRMHSIYCKTV
Download sequence
Identical sequences F7CPK2
ENSMODP00000023704 ENSMODP00000023704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]