SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023766 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023766
Domain Number 1 Region: 923-971
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000188
Family Myb/SANT domain 0.007
Further Details:      
 
Domain Number 2 Region: 1060-1084,1127-1154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000366
Family Classic zinc finger, C2H2 0.069
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023766
Domain Number - Region: 528-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00139
Family Plant C2H2 finger (QALGGH zinc finger) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023766   Gene: ENSMODG00000019042   Transcript: ENSMODT00000024189
Sequence length 1244
Comment pep:known_by_projection chromosome:BROADO5:2:286226570:286388049:-1 gene:ENSMODG00000019042 transcript:ENSMODT00000024189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDQQMYKANHTVHGNENLYYQQPPHNALSGGNGINHSYGGTASAGGGMEASQTSPLSPH
FPQDSQESLGLATGSKNLGLMDNSRQESWGGHAGPNNHIQLRGGLTNPNVMWGASAQVEP
AEGYPYAYPQASDLRAQKITSGVLHKLDSFTQVFANQNLRIQVNNMAQVLHSQSSVMDGS
NDSALRQLLSQKPSEPQAVTAPPAVPPRYQQIPHQAHTGFANGPPRPPALQGGQHPSQAH
LYYDYQQQMAQMPAQGGQPMQSQQMLPQPMPQMQQAHYYLQQPQSGQQRIPIPDMQQQQQ
QQQQQQQQSRAQQLLPPPPPQRPCSIQLPHYYPTQPMMPQLQQQQQQPQPPPMQLQPSSY
HREPGPKSVHDPHQYSQEQASHPVQLIQLGSVPQYFYQDPQPQYSRHFYQQSLLQQQQQQ
QQHRDNVQQKSYQGDRQAQAMLASHGGLGLPDPGVEEMNSVGNSLTHRPLLSQVGIHLNS
KGPPHPQLSPGSVWSQMHLSDGRAQPVSPDPSAQPPGAFGEQLDAKNKLTCSICFKEFKS
LPALNGHMRSHGGMRASPNFKQEEGEKALQLQPPLPPQQQQPPPPPLPPQSQLPPEVENP
LPIVMPVSVPVKLLSPEPSPQVITNNITAARDKPASSMSDDEMPVLVRMTLSPPNSPKVA
APCAPSEIPRKHQPGMARAEEHFKPTQDKKKYRHRPEPLFIPPPSFNQNASSYSAATLYQ
SQLRSPRILGDHLLDPAHELPPYTPPPMLSPVRQGSGLFSNVISTSSQGVPHPQLPLTPL
TPTPRVLLCRSNSVDGGNPALTPGLGEQSVDIEPRINIGVRFQAEIPELQDVSSLCNDTH
KATLVWKPWPELENKEFQKRVENLLNLCCSSALPGGGTNSEFALHSLFEAKGDIMAALEM
LLLKKPIRFKCHPLANYHYAGSDKWTSLERKLFNKALATYSKDFIFVQKMVKSKTVAQCV
EYYYTWKKIMRLGRKHRTRLADIIDDCAVNGTLRKTPLGGTKTSEEEEEIEDDDDLEEDR
KSTKDDDPDVQKSPDPPPITLVAPIDLPSLQSLTPSSVSFVCEMPNCGAVFSSRQALNGH
ARIHGGTNQVAKARCSVPPAKQKQGAQSGYCSVKSSPAHSTTSGETDPTTVFPCKECGKV
FFKIKSRNAHMKTHRQQEEQQRQKAQKAAVAAEMAAAIERTTGPVGPGLIPLDHLSLIKH
VEDVDILGDDVVQELGGVMEQTEVVGTDLLLDDDTTLLQGDTEL
Download sequence
Identical sequences F7AYX0
XP_007483982.1.35504 XP_016286556.1.35504 XP_016286557.1.35504 XP_016286558.1.35504 XP_016286559.1.35504 XP_016286560.1.35504 XP_016286561.1.35504 ENSMODP00000023766 ENSMODP00000023766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]