SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024051 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024051
Domain Number 1 Region: 726-796,848-1007
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-58
Family Tandem AAA-ATPase domain 0.0000896
Further Details:      
 
Domain Number 2 Region: 498-724
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.23e-54
Family Tandem AAA-ATPase domain 0.0000992
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024051
Domain Number - Region: 249-300
Classification Level Classification E-value
Superfamily UBA-like 0.00194
Family CUE domain 0.031
Further Details:      
 
Domain Number - Region: 397-432
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00845
Family ComEA-like 0.08
Further Details:      
 
Domain Number - Region: 27-36
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024051   Gene: ENSMODG00000019268   Transcript: ENSMODT00000024478
Sequence length 1028
Comment pep:known_by_projection chromosome:BROADO5:5:28789728:28888040:-1 gene:ENSMODG00000019268 transcript:ENSMODT00000024478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHFNLDRFRFEKRNKIQEQPEPAPQPPPPTPPPPPQVELPSPVSIIEDDDLERGKGSRP
GTPDSDITEKTEDSSVPETPEPERKSGVSYFRNQKGIQFIDLSSDSEDFASPNCSNINQE
EKSEREPVIIVSEQSEDEQTEEYSNMTQRNDDISELEDLKDAKLQTLKELFPQGSDSDLL
KLIESTSTMDGAIAAALLMFGEGIPRKRKLDSSSSYTSEDEDDENNQTVKRKRFHPLEEP
KDFEESEDKWDKQEAIVAKLQTEFPSLAKEELREVLKEHEWMYNEALESLRVFAEDQQDV
QYPSKSEVSNGKAVSRKSQNHLKNTPKTKLKQKCSVKAQNGFNKKGKKTFFTSKKEMPDS
EFDSGSDVGSSLDEDYSSGEEVMEDGYKGKILHFLQGASIGELTLIPQCSQKKAQKITEL
RPFNSWEALFTKMCKTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNKLTKQVTRLTE
GGGGWNIDQPSILNQSLSLKPYQKIGLNWLALLHKHGLNGILADEMGLGKTIQAISFLAY
LYQEGNRGPHLIVVPASTLDNWIRDVNLWCSNLDVLFYYGSQEDRKQLRYDIHNKVVDFN
VIVTTYNCAISSSDDRNLFRRLKLNYAIFDEGHMLKNMGSVRYQHLMTINAKNRLLLTGT
PVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKAKSAEEQSIYEKERIAHAKQIIKPF
ILRRVKEEVLKQLPPKKDCVELCAMSEKQEQLYFGLFNKMKKSINGMEKSSEMGNVMMQL
RKMANHPLLHRQYYTAEKLKIMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHLLCKQYA
HINDFMLDMDLILDSGKFKKLECILSELKEKGDRVVLFSQFTMMLDILEVLLKHHQHRYL
RLDGKTQISERIHLIDQFNTDMDIFIFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQ
AEDRCHRVGQTKEVHVIKLISQGTIEESMLKINQQKLKLEQDMTTTDEGDEGNVPADIAT
LLKTSLGL
Download sequence
Identical sequences F6SI67
XP_007495789.1.35504 ENSMODP00000024051 ENSMODP00000024051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]