SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024064 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024064
Domain Number 1 Region: 80-173,209-455,556-656
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.7e-31
Family LacY-like proton/sugar symporter 0.074
Further Details:      
 
Domain Number 2 Region: 477-528
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000333
Family Ovomucoid domain III-like 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024064
Domain Number - Region: 43-52
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024064   Gene: ENSMODG00000019279   Transcript: ENSMODT00000024491
Sequence length 705
Comment pep:known_by_projection chromosome:BROADO5:3:4036966:4162810:-1 gene:ENSMODG00000019279 transcript:ENSMODT00000024491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDGGIDNPAFVPSSPSLARHLPASPAEVEVSVQTSPSEELPPPPPPPPPPQPAQVAEL
EEGPCGWGRFTPAFLQRCNNPKGFLFHYCLLALIQGIVVNGLVNISISTIEKRYELKSSL
TGLVSSSYDISFCMLSLFVSFFGERGHKPRWLAFASFMMGLGSLIFSLPHFTSGEYHFGS
KFEDTCPATGNVSNCRDVSSKLSSYLYVFILGQLLLGVGGTPLYTLGTAFIDDSVPTHKS
SLYIGIGFSMSVLGPAIGYVLGGQLLKIYIDADMGKRTFIAEDDPRWLGAWWIGFILSWF
LSWSLIVPFSCFPKQLPGTAETQAGKVSQAHQNGSAIQTSDKNFGKSIKDFPAALQTLLR
NSVFMCLALSTSTEALITTGFATFLPKFIENQFGLSSSFAATLGGVVLIPGAALGQVLGG
VIVSKFKMACKNIMKFSLLMSVLSLILSFVFIFAKCGNEPFAGVSEAYNGTGELGNLTAP
CNVNCNCLDSFYYPVCGRDGVQYFSPCIAGCKNSVPQSQPKVYHNCSCIGSPEYAMPSAE
SLGYEAKAGKCESRCTNLPLFLGFFFVTVIFTFMAGTPITVAILRCVNTYQRSLALGVQF
VLVRLLGTIPGPIVFGFAIDSSCTLWDVNQCGIRGACWLYDNTKMAFMLVGISFGCKVLT
IFFNALAIFLYKPPPSGTNVTFQNENIVVASVPAEPDHSKMRHDG
Download sequence
Identical sequences F6SHD5
XP_001379961.1.35504 ENSMODP00000024064 ENSMODP00000024064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]