SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024150 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024150
Domain Number 1 Region: 442-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.13e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 51-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.43e-25
Family SCAN domain 0.00024
Further Details:      
 
Domain Number 4 Region: 526-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.46e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 583-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.11e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 628-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 292-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 161-217
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000314
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 
Domain Number 9 Region: 489-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000455
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 10 Region: 405-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000456
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024150   Gene: ENSMODG00000019354   Transcript: ENSMODT00000024578
Sequence length 686
Comment pep:known_by_projection chromosome:BROADO5:1:112114927:112140854:1 gene:ENSMODG00000019354 transcript:ENSMODT00000024578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEVPGMTAVLDSLAQTPEEEEEEEEEASTMMLEDEDSSWKPGLALQGDSCTPESFHQI
KSKVEYQEAAKPRESLSRLRELCQRWLRPELHTKEQMLTLLPGEIQAWLREHRPESSKEA
VALVEDLTETLRESALSITRVPAFSEEDSSEDQVMEAALLMARAQGPGTFKDGEVSLSQE
EQESLDAAPKDLCGDVMQENYGNDLSHDFEIQSENEENSNQEIFEAVEENMLSGRPEGEG
IQHSDWGSDFERDYGIERPQGNSQEGEYGETTFQDREIGQFIGLQGTYLGEKPYECPQCG
KTFSRKSHLITHERTHTGEKYYKCDECGKSFSDGSNFSRHQTTHTGEKPYKCRDCGKSFS
RSANLITHQRIHTGEKPFQCAECGKSFSRSPNLIAHQRTHTGEKPYSCLECGKSFGNRSS
LNTHQGIHTGEKPYECKECGESFSYNSNLIRHQRIHTGEKPYKCTDCGQRFSQSSALITH
RRTHTGEKPYQCNECGKSFSRSSNLATHRRTHMVEKPYKCGECGKSFSQSSSLIAHQGMH
TGEKPYECLTCGESFSWSSNLIKHQRIHTGEKPYKCSECGKCFSQRSQLVVHQRTHTGEK
PYKCLMCGKSFSRGSILVMHQRAHLGDKPYRCPECGKGFSWNSVLIIHQRIHTGERPYKC
PECGKGFSNSSNFITHQRTHMKEKLY
Download sequence
Identical sequences F6X979
ENSMODP00000024150 ENSMODP00000024150 XP_007479279.1.35504 XP_007479280.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]