SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024155 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024155
Domain Number 1 Region: 41-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.6e-39
Family SCAN domain 0.0000439
Further Details:      
 
Domain Number 2 Region: 894-951
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.48e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 951-1007
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.11e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 838-895
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 992-1044
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.38e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 796-848
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000578
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 228-287
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000942
Family KRAB domain (Kruppel-associated box) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024155   Gene: ENSMODG00000019359   Transcript: ENSMODT00000024583
Sequence length 1053
Comment pep:novel chromosome:BROADO5:1:112147464:112157820:1 gene:ENSMODG00000019359 transcript:ENSMODT00000024583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVLDPQVQAPRAQDGFLIVKLEDDSHWHQESFLHRNVHSPEASCQRFWQFHYQEAAGP
REALNQLRELCRQWLRPEKCTKEQILELLVLEQFLTVLPREIQTWVREQHPENGEEAVTL
VENMQREPGRSAMKVPVVMKGQEVLTEMVTTTESVPNSLSIHLKQTQTKSKCTFQENAER
LHLEPEKELSCDPKIEPHSLQESALSASQVLDLPVEASSGNQEMVGKSQDLVTFGDVAIY
FSQEAQGQLDSAPQDFCQDQTQENENGVSQRFPIPRTSMISQIEQGEKLQNLDLQGCKEK
ENSRDSRMVGERTKIGQAPVMKKVKHWEELERQGLDDEKVAGVHWGYEETKIFLGILSES
WIYEKLRTCHRNRQVYRIVAERLRERGFLRTLEQCRYRFKNLQTNYRKARSTHTPGTCPF
YEEMDALMSPRVAVTAPEVEGDLGQGDHDIESEELERDNWEHEDIAMAGVVLEGGSRQLD
LSHPAASLEELHSGAVSEDSDGEELGNDEPSESPGTQTLFRSATGVHWGYEETKIFLGIL
GEPRIYEKLRTCHRNRQVYRIVAERLRECGFLRTLEQCRYRFKNLQTHYRKARSGHTPET
CPFYEEMDALMSPWTAITPLDVLEMAGGLLKGKVESKENTNWENPETVTEVGNHVEVEEP
PKEVKNFKLEAVFQNSSELPIHKPDSNPKPEVGEELQNVNFHDFKEIQRTSHTDFEMTGK
HEKNPSQEISEGVELHATSLGSSKGNASHYLNWKKAQEGEYRTERQWEMLPGEEQGPPSP
QERNLGNFIGLQGTYIGENPNTCSECGKNFSQSSHLAVHRLAHIGEKKLHDCEECGKTFS
RSSHLICHQRIHTGEKPYKCPECRKGFSDHSNLTAHQRIHTGEKPYKCSECWKSFNQSSS
LIMHQRIHTGEKPHKCSECGKSFTNSSHFNAHWRTHTGEKPYQCPECGKRFSKSSTLTSH
QRIHTGEKPYECLECGKSFSDRSNLITHRRIHTGERPYKCGECGKSFNQSSSLIIHQRIH
TGEKPYECNECGRRFNNSSHFSAHRRTHVGEKH
Download sequence
Identical sequences F6X920
ENSMODP00000024155 ENSMODP00000024155 XP_007479273.1.35504 XP_007479275.1.35504 XP_007479276.1.35504 XP_016282083.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]