SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024348 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024348
Domain Number 1 Region: 498-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 330-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-17
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 3 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000324
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 539-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000414
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 291-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000122
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 386-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000489
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024348   Gene: ENSMODG00000019518   Transcript: ENSMODT00000024778
Sequence length 662
Comment pep:known_by_projection chromosome:BROADO5:1:121881965:121957602:-1 gene:ENSMODG00000019518 transcript:ENSMODT00000024778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERFIDSGTQTEAVVVLSLAQAAVLGLVSENELFGATISPEAFYPVLGHELSDTAAVEPE
PPDNDYQLECAGGAPGEPPEEEVLEVGAAFEKHTRRRKRPPVRLVPKVKYEEMEDDHEED
VFEVSVPADERQEAPGEPPEEAGCEGLVQSSSVKMIDLSSFGRKSRRRVARTPRPPELDG
GAAYHGHFADSAPDGYAEPNMVLTRAASEALQQECGFEPHLTSLSDAEAPAAESPEPVKN
DQGFVWQDPGEFEADPAGSTAEHHKKAQLDRLDINVQIDDSYLVEAGDRQKRWQCRMCEK
SYTSKYNLVTHILGHNGIKPHSCPHCSKLFKQPSHLQTHLLTHQGTRPHKCEVCHKAFTQ
TSHLKRHMLLHSDIKPYSCHFCGRGFAYPSELKAHEVKHENGRCHVCVECGLDFSTLTQL
KRHLATHQGPTLYQCLECSKSFHYRSQLQNHMLKHQNVRPFVCTECGMEFSQIHHLKQHS
LTHKGVKEFKCEVCGREFTLQANMKRHMLIHTSVRPYQCHICFKTFVQKQTLKTHMIVHS
PVKPFKCKVCGKSFNRMYNLLGHMHLHAGSKPFKCPYCSSKFNLKGNLSRHMKVKHGVMD
ISLDSQDPMMELAGADHSELDGPQEMEDYEENSFDYSGVENGADDSALTEQAMKEMAYYN
VL
Download sequence
Identical sequences F6VD56
13616.ENSMODP00000024348 XP_003340023.1.35504 XP_007479386.1.35504 XP_016283366.1.35504 ENSMODP00000024348 ENSMODP00000024348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]