SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024360 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024360
Domain Number 1 Region: 206-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.83e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 2 Region: 149-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000429
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 242-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000085
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024360   Gene: ENSMODG00000019528   Transcript: ENSMODT00000024790
Sequence length 302
Comment pep:known_by_projection chromosome:BROADO5:1:403159093:403174504:-1 gene:ENSMODG00000019528 transcript:ENSMODT00000024790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKKIKADAFQCSSVPAPSYHPLGSAYVLPGSRGAAGPAGDSGYAPHCLPPPSYD
AEKKPGLELAPSEAAYPPATEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAFFISDGRS
RRRGTGDARGPGGGNGAGGTGGGSGGHRHSCGECGKTYATSSNLSRHKQTHRSLDSKLAR
KCPTCGKAYVSMPALAMHVLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCSHCG
KAFADRSNLRAHMQTHSAFKHYKCRQCEKTFALKSYLNKHCEAACFKGAEHACTASAAAM
DN
Download sequence
Identical sequences F6UV56
ENSMODP00000024360 ENSMODP00000024360 XP_001366400.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]